Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00607
Gene name
Locationscaffold_01:2375347..2375951
Strand+
Gene length (bp)604
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 3.2E-22 41 111
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 8.6E-07 42 107

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0046983 protein dimerization activity Yes
GO:0006351 transcription, DNA-templated Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0005515 protein binding No
GO:0097659 nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0003824 catalytic activity No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0097747 RNA polymerase activity No
GO:0034062 5'-3' RNA polymerase activity No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7511 0.5577 0.0522 0.1604 0.2023 0.0013 0.0388 0.0635 0.0277 0.0195

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|703
Ophiocordyceps australis map64 (Brazil) OphauB2|3584
Ophiocordyceps camponoti-floridani Ophcf2|00607 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|397
Ophiocordyceps kimflemingae Ophio5|4272
Ophiocordyceps subramaniannii Hirsu2|10193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00607
MAGCNSRHYNLQDNVFELFLLADGEKKIEEKVYSGMSNTSDFILNKEDHTLGNLLSEHIKKHPNVYMAGYKLAHP
NVPQLFIRVQTDGSKTPREVFCAVCEKLINQLELLHQAFTREWELRRITNIGEQAMQANGHQA*
Coding >Ophcf2|00607
ATGGCCGGTTGCAACTCCCGACATTACAACCTCCAGGATAACGTCTTCGAACTCTTCCTGCTCGCAGATGGCGAG
AAGAAGATCGAGGAAAAGGTGTACTCTGGAATGTCCAACACCTCGGATTTCATCCTCAACAAGGAAGATCATACC
TTGGGAAATCTTCTCTCCGAGCATATCAAGAAACATCCCAACGTGTACATGGCCGGCTACAAGCTCGCCCATCCA
AATGTCCCGCAGCTTTTCATTCGTGTCCAAACGGATGGCAGCAAGACGCCTCGCGAAGTCTTTTGTGCCGTGTGC
GAAAAGCTCATCAATCAGCTTGAGTTGTTGCATCAAGCATTCACCCGCGAATGGGAACTGCGCCGCATCACCAAC
ATTGGTGAGCAGGCCATGCAGGCTAACGGGCATCAAGCATAG
Transcript >Ophcf2|00607
ATGGCCGGTTGCAACTCCCGACATTACAACCTCCAGGATAACGTCTTCGAACTCTTCCTGCTCGCAGATGGCGAG
AAGAAGATCGAGGAAAAGGTGTACTCTGGAATGTCCAACACCTCGGATTTCATCCTCAACAAGGAAGATCATACC
TTGGGAAATCTTCTCTCCGAGCATATCAAGAAACATCCCAACGTGTACATGGCCGGCTACAAGCTCGCCCATCCA
AATGTCCCGCAGCTTTTCATTCGTGTCCAAACGGATGGCAGCAAGACGCCTCGCGAAGTCTTTTGTGCCGTGTGC
GAAAAGCTCATCAATCAGCTTGAGTTGTTGCATCAAGCATTCACCCGCGAATGGGAACTGCGCCGCATCACCAAC
ATTGGTGAGCAGGCCATGCAGGCTAACGGGCATCAAGCATAG
Gene >Ophcf2|00607
ATGGCCGGTTGCAACTCCCGACATTACAACCTCCAGGATAACGTGTAGCGTCTCGCCCGCGGATCAGAAAAAAAA
TCGCATCACCAAAGCACGTCACCCGCTAATCACGCCTCTAGCTTCGAACTCTTCCTGCTCGCAGATGGCGAGAAG
AAGATCGAGGAAAAGGTGTACTCTGGTAACAACGACTATTCCTGCCCCCCTCAAACGCATCACCGCTGATGCCCT
GCAAGGAATGTCCAACACCTCGGATTTCATCCTCAACAAGGAAGATCATACCTTGGGAAATCTTCTCTCCGAGCA
TATCAAGAAACATCCCAACGTGTACATGGCCGGCTACAAGCGTATGTGTCGGTCTGCACTTCGCTTCTGTGCCCT
CCGCTGACTGGCATCACGTCGTCCAGTCGCCCATCCAAATGTCCCGCAGCTTTTCATTCGTGTCCAAACGGATGG
CAGCAAGACGCCTCGCGAAGTCTTTTGTGCCGTGTGCGAAAAGCTCATCAATCAGCTTGAGTTGTTGCATCAAGC
ATTCACCCGCGAATGGGAACTGCGCCGCATCACCAACATTGGTGAGCAGGCCATGCAGGCTAACGGGCATCAAGC
ATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail