Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00604
Gene name
Locationscaffold_01:2366869..2369225
Strand-
Gene length (bp)2356
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00955 HCO3_cotransp HCO3- transporter family 6.1E-27 34 193
PF00955 HCO3_cotransp HCO3- transporter family 3.6E-36 204 476

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006820 anion transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 104 126 22
3 141 163 22
4 170 188 18
5 203 225 22
6 237 259 22
7 287 309 22
8 335 357 22
9 414 436 22
10 473 507 34

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00604
MDKTVDAFSRPAPDTPRAPPDEGRCHDPWWRLHLFRGILNDIRRRAPFYPSDWRDAWDYRVVPATIYMYFANILP
ALAFSLDISRRCCLLPLRRAAHCHCWRHWLAVVVSPFLSLLTCLTGPITVFNYTVYDIMSPSGVNYIGFMAWIGI
WALILHWILAITNSCNWLRWVTRFPCDIFGFYVAFIYLQKGIQVLDRLGDGTSFYLSIVAALLVFMSAYICGQLG
TSSLFRHPIRVFLKDYGTPLTLIFFTAFVHFGRMNQVELERLPTGIAFMPTSGRAWLVDFWTLSVGQVFTALPFA
ILLTILFWFDHNVSSLMAQGSEFPLRKPAGFHWDLFLLGVTTGVAGILGLPFPNGLIPQAPFHTDSLCVTKPVRK
LDGQGEDRGDYAFEASHVVEQRVSNLAQGLLTLGTMTGPLLVVIHLIPHGVLAGLFFVMGVQALEANGITAKLLF
LCRDKNLTPADQPLRTIKRRVAIWLFVAIELAGFGATFAVTQTVAAVGFPIFIIALIPVRTKLLPLIFRPEELAV
LDAPTASDFIMEGIGGGKKNSSSSSHTASDAPSPLRSRSRSPSASRGENQQAGAATGRKTVEDAAELGQAQSEQR
SAMRRRGDDIHG*
Coding >Ophcf2|00604
ATGGACAAGACAGTCGACGCCTTCTCACGGCCAGCCCCGGACACGCCACGAGCACCGCCCGATGAAGGCCGTTGT
CATGATCCCTGGTGGCGTCTTCATCTCTTCCGCGGCATTCTCAACGATATCCGCCGGAGGGCTCCTTTCTACCCG
AGCGACTGGCGCGATGCCTGGGATTATCGCGTCGTCCCGGCCACAATTTACATGTATTTCGCAAACATTCTCCCG
GCCCTTGCCTTTTCCCTCGACATTTCTCGGCGCTGTTGTCTTCTCCCTCTTCGCCGCGCAGCCCATTGTCATTGT
TGGCGTCACTGGTTAGCTGTTGTAGTCTCCCCTTTCCTTTCTCTGCTGACCTGCCTCACTGGCCCCATAACCGTC
TTCAACTACACAGTTTACGACATCATGAGCCCTAGTGGCGTCAACTACATAGGGTTCATGGCCTGGATCGGCATA
TGGGCGCTTATCCTTCACTGGATCCTAGCCATTACAAATTCGTGTAACTGGCTCCGCTGGGTTACGCGATTCCCC
TGCGACATCTTCGGCTTCTATGTCGCCTTCATCTATCTTCAGAAGGGTATCCAGGTCCTAGACCGCCTCGGAGAC
GGTACTTCCTTCTATCTGTCCATAGTCGCAGCCCTACTGGTATTCATGTCGGCCTACATCTGCGGCCAACTGGGA
ACCAGCAGCCTATTCAGACATCCGATCCGAGTCTTCCTCAAAGACTACGGCACTCCTCTGACCCTCATCTTCTTC
ACGGCCTTCGTCCACTTCGGCCGCATGAACCAAGTTGAACTCGAGAGACTACCGACGGGCATTGCCTTTATGCCC
ACCAGTGGTCGAGCCTGGCTCGTCGACTTTTGGACCTTGAGCGTGGGCCAAGTATTTACGGCTCTGCCGTTTGCC
ATCCTACTCACCATTCTCTTCTGGTTCGATCACAATGTTTCTTCCCTCATGGCGCAAGGAAGTGAGTTTCCGCTG
CGCAAGCCGGCTGGCTTTCACTGGGATCTCTTTCTCCTCGGTGTCACAACTGGAGTCGCAGGAATTCTCGGCCTG
CCGTTCCCCAACGGACTCATTCCGCAGGCCCCATTTCACACCGATTCTCTCTGCGTGACGAAGCCGGTGAGAAAG
CTGGACGGCCAGGGTGAGGATAGAGGCGACTACGCCTTCGAGGCTTCGCATGTCGTCGAGCAGCGCGTATCAAAC
CTTGCACAGGGGCTCCTGACGCTCGGCACAATGACCGGGCCGTTGCTCGTCGTCATTCATCTCATCCCCCATGGC
GTCCTCGCCGGCCTCTTCTTCGTCATGGGCGTCCAGGCGCTCGAGGCCAACGGCATCACCGCCAAGTTGCTGTTT
CTCTGTCGCGACAAGAATCTGACGCCCGCGGACCAACCTCTCAGGACGATTAAGCGTCGCGTCGCCATTTGGCTC
TTTGTCGCCATCGAGCTCGCTGGCTTCGGTGCCACCTTTGCCGTCACCCAAACGGTTGCTGCTGTCGGCTTCCCC
ATCTTCATCATTGCCCTCATTCCAGTCCGCACAAAGCTTCTCCCGCTCATCTTCCGTCCTGAGGAGCTGGCTGTG
CTGGACGCGCCGACTGCCTCGGACTTTATCATGGAGGGCATCGGAGGCGGTAAGAAGAATAGCAGCAGCAGTAGC
CACACGGCTTCAGATGCCCCTTCGCCTTTGAGGTCGCGGTCGCGGTCGCCTTCCGCCAGCCGAGGTGAAAATCAG
CAGGCGGGCGCAGCGACCGGTCGGAAGACGGTGGAGGATGCGGCTGAGCTGGGGCAGGCGCAGAGCGAGCAGAGA
TCGGCCATGAGGAGGAGAGGCGATGATATCCATGGATAG
Transcript >Ophcf2|00604
ATGGACAAGACAGTCGACGCCTTCTCACGGCCAGCCCCGGACACGCCACGAGCACCGCCCGATGAAGGCCGTTGT
CATGATCCCTGGTGGCGTCTTCATCTCTTCCGCGGCATTCTCAACGATATCCGCCGGAGGGCTCCTTTCTACCCG
AGCGACTGGCGCGATGCCTGGGATTATCGCGTCGTCCCGGCCACAATTTACATGTATTTCGCAAACATTCTCCCG
GCCCTTGCCTTTTCCCTCGACATTTCTCGGCGCTGTTGTCTTCTCCCTCTTCGCCGCGCAGCCCATTGTCATTGT
TGGCGTCACTGGTTAGCTGTTGTAGTCTCCCCTTTCCTTTCTCTGCTGACCTGCCTCACTGGCCCCATAACCGTC
TTCAACTACACAGTTTACGACATCATGAGCCCTAGTGGCGTCAACTACATAGGGTTCATGGCCTGGATCGGCATA
TGGGCGCTTATCCTTCACTGGATCCTAGCCATTACAAATTCGTGTAACTGGCTCCGCTGGGTTACGCGATTCCCC
TGCGACATCTTCGGCTTCTATGTCGCCTTCATCTATCTTCAGAAGGGTATCCAGGTCCTAGACCGCCTCGGAGAC
GGTACTTCCTTCTATCTGTCCATAGTCGCAGCCCTACTGGTATTCATGTCGGCCTACATCTGCGGCCAACTGGGA
ACCAGCAGCCTATTCAGACATCCGATCCGAGTCTTCCTCAAAGACTACGGCACTCCTCTGACCCTCATCTTCTTC
ACGGCCTTCGTCCACTTCGGCCGCATGAACCAAGTTGAACTCGAGAGACTACCGACGGGCATTGCCTTTATGCCC
ACCAGTGGTCGAGCCTGGCTCGTCGACTTTTGGACCTTGAGCGTGGGCCAAGTATTTACGGCTCTGCCGTTTGCC
ATCCTACTCACCATTCTCTTCTGGTTCGATCACAATGTTTCTTCCCTCATGGCGCAAGGAAGTGAGTTTCCGCTG
CGCAAGCCGGCTGGCTTTCACTGGGATCTCTTTCTCCTCGGTGTCACAACTGGAGTCGCAGGAATTCTCGGCCTG
CCGTTCCCCAACGGACTCATTCCGCAGGCCCCATTTCACACCGATTCTCTCTGCGTGACGAAGCCGGTGAGAAAG
CTGGACGGCCAGGGTGAGGATAGAGGCGACTACGCCTTCGAGGCTTCGCATGTCGTCGAGCAGCGCGTATCAAAC
CTTGCACAGGGGCTCCTGACGCTCGGCACAATGACCGGGCCGTTGCTCGTCGTCATTCATCTCATCCCCCATGGC
GTCCTCGCCGGCCTCTTCTTCGTCATGGGCGTCCAGGCGCTCGAGGCCAACGGCATCACCGCCAAGTTGCTGTTT
CTCTGTCGCGACAAGAATCTGACGCCCGCGGACCAACCTCTCAGGACGATTAAGCGTCGCGTCGCCATTTGGCTC
TTTGTCGCCATCGAGCTCGCTGGCTTCGGTGCCACCTTTGCCGTCACCCAAACGGTTGCTGCTGTCGGCTTCCCC
ATCTTCATCATTGCCCTCATTCCAGTCCGCACAAAGCTTCTCCCGCTCATCTTCCGTCCTGAGGAGCTGGCTGTG
CTGGACGCGCCGACTGCCTCGGACTTTATCATGGAGGGCATCGGAGGCGGTAAGAAGAATAGCAGCAGCAGTAGC
CACACGGCTTCAGATGCCCCTTCGCCTTTGAGGTCGCGGTCGCGGTCGCCTTCCGCCAGCCGAGGTGAAAATCAG
CAGGCGGGCGCAGCGACCGGTCGGAAGACGGTGGAGGATGCGGCTGAGCTGGGGCAGGCGCAGAGCGAGCAGAGA
TCGGCCATGAGGAGGAGAGGCGATGATATCCATGGATAG
Gene >Ophcf2|00604
ATGGACAAGACAGTCGACGCCTTCTCACGGCCAGCCCCGGACACGCCACGAGCACCGCCCGATGAAGGCCGTTGT
CATGATCCCTGGTGGCGTCTTCATCTCTTCCGCGGCATTCTCAACGATATCCGCCGGAGGGCTCCTTTCTACCCG
AGCGACTGGCGCGATGCCTGGGATTATCGCGTCGTCCCGGCCACAATTTACATGTATTTCGCAAAGTAGGGCTTT
TCCTGATTTGCGGCAACTTGCGGCGAAGCTCATTGGCGCCTCGCAGCATTCTCCCGGCCCTTGCCTTTTCCCTCG
ACATGTTCCAGAAGACGGGATCCAACTACGGCGTCAATGAGGTCCTGCTGGCTTCAGTTCTCGGCGCTGTTGTCT
TCTCCCTCTTCGCCGCGCAGCCCATTGTCATTGTTGGCGTCACTGGTTAGCTGTTGTAGTCTCCCCTTTCCTTTC
TCTGCTGACCTGCCTCACTGGCCCCATAACCGTCTTCAACTAGTTCGTGCCTGTACCCTCTTTGCTTTCTCTGTC
TTACAGCGCTTTAACACTCGCATAGCACAGTTTACGACATCATGAGCCCTAGTGGCGTCAACTACATAGGGTTCA
TGGCCTGGATCGGCATGTGAGCACATCTCTTACACCTCGATGAACCCCTTTGAGCCCACTGTGCCCGTCTCATCT
TACGCTTTCCAGATGGGCGCTTATCCTTCACTGGATCCTAGCCATTACAAATTCGTGTAACTGGCTCCGCTGGGT
TACGCGATTCCCCTGCGACATCTTCGGCTTCTATGTCGCCTTCATCTATCTTCAGAAGGGTATCCAGGTCCTAGA
CCGCCTCGGAGACGGTACTTCCTTCTATCTGTCCATAGTCGCAGCCCTACTGGTATTCATGTCGGCCTACATCTG
CGGCCAACTGGGAACCAGCAGCCTATTCAGACATCCGATCCGAGTCTTCCTCAAAGACTACGGCACTCCTCTGAC
CCTCATCTTCTTCACGGCCTTCGTCCACTTCGGCCGCATGAACCAAGTTGAACTCGAGAGACTACCGACGGGCAT
TGCCTTTATGCCCACCAGTGGTCGAGCCTGGCTCGTCGACTTTTGGACCTTGAGCGTGGGCCAAGTATTTACGGC
TCTGCCGTTTGCCATCCTACTCACCATTCTCTTCTGGTTCGATCACAATGGTACGCATCGATTTAGAGGTGACTT
TCGCTCAGCGGCTCAGGCTGATACATAACTCTTCTTATCAGTTTCTTCCCTCATGGCGCAAGGAAGTGAGTTTCC
GCTGCGCAAGCCGGCTGGCTTTCACTGGGATCTCTTTCTCCTCGGTGTCACAACTGGAGTCGCAGGAATTCTCGG
CCTGCCGTTCCCCAACGGACTCATTCCGCAGGCCCCATTTCACACCGATTCTCTCTGCGTGACGAAGCCGGTGAG
AAAGCTGGACGGCCAGGGTGAGGATAGAGGCGACTACGCCTTCGAGGCTTCGCATGTCGTCGAGCAGCGCGTATC
AAACCTTGCACAGGGGCTCCTGACGCTCGGCACAATGACCGGGCCGTTGCTCGTCGTCATTCATCTCATCCCCCA
TGGCGTCCTCGCCGGCCTCTTCTTCGTCATGGGCGTCCAGGCGCTCGAGGCCAACGGCATCACCGCCAAGTTGCT
GTTTCTCTGTCGCGACAAGAATCTGACGCCCGCGGACCAACCTCTCAGGACGATTAAGCGTCGCGTCGCCATTTG
GCTCTTTGTCGCCATCGAGCTCGCTGGCTTCGGTGCCACCTTTGCCGTCACCCAAACGGTTGCTGCTGTCGGCTT
CCCCATCTTCATCATTGCCCTCATTCCAGTCCGCACAAAGCTTCTCCCGCTCATCTTCCGTCCTGAGGAGCTGGC
TGTGCTGGACGCGCCGACTGCCTCGGACTTTATCATGGAGGGCATCGGAGGCGGTAAGAAGAATAGCAGCAGCAG
TAGCCACACGGCTTCAGATGCCCCTTCGCCTTTGAGGTCGCGGTCGCGGTCGCCTTCCGCCAGCCGAGGTGAAAA
TCAGCAGGCGGGCGCAGCGACCGGTCGGAAGACGGTGGAGGATGCGGCTGAGCTGGGGCAGGCGCAGAGCGAGCA
GAGATCGGCCATGAGGAGGAGAGGCGATGGTCGGTAGAAGTTGCTCCTAACTTGCTGACCGGCTCTCAGGATGGT
GACATGATTTTGACGTTGGTGTGGATTCTGACAAGATATCCATGGTGAGTTTGACTTGGTCTGCTTATGAGATAT
GCGCTCTTTCTCTTGTCTTTCCGTTCTTCGTTTCACCTTGGCGTTACGAAGTTGAGATGACTTCCTCTGCCATGG
AAAGTCTAGAGTTGATGACGGCACAGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail