Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00602
Gene name
Locationscaffold_01:2361538..2362615
Strand-
Gene length (bp)1077
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 1.9E-52 37 218
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 7.6E-33 225 321

GO

GO Term Description Terminal node
GO:0006631 fatty acid metabolic process Yes
GO:0070403 NAD+ binding Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0051287 NAD binding No
GO:0044255 cellular lipid metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0036094 small molecule binding No
GO:0006082 organic acid metabolic process No
GO:0043167 ion binding No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1214 0.0746 0.0855 0.0639 0.9409 0.0559 0.0374 0.0225 0.0362 0.0196

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1128
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6480
Ophiocordyceps australis map64 (Brazil) OphauB2|3579
Ophiocordyceps camponoti-floridani Ophcf2|00602 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|403
Ophiocordyceps kimflemingae Ophio5|8204
Ophiocordyceps subramaniannii Hirsu2|10188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00602
MTSSIFRTQAFKAARIASQARSFSCLSSRQAADVNSLGVIGAGQMGLGIALVAAQKAQIPVTLIDSSDKALDKGL
AFADKLLAKDVSKSRITQEQADKARSLLKPSTSIEDLRSVDFVIEAVPEIPKLKFEIFGNLARICPKHAILATNT
SSISITRIAAATTNNPTDTSASSRVVSTHFMNPVPVQKGVEIISGLQTSKETVETAVEFCKRMGKIASVSADSPG
FLANRILMPYINEAIICLETGVGDRDSIDAIMKNGTNVPMGPLQLADFIGLDTCQSIMKVLHEETGDSKYRPSIL
LGKMVDAGWVGKKSGKGFYDY*
Coding >Ophcf2|00602
ATGACGAGCTCGATTTTCCGGACTCAGGCCTTCAAGGCCGCACGCATAGCGTCTCAGGCGCGCAGCTTCAGCTGC
CTCTCGTCCAGGCAAGCCGCAGATGTCAACAGCCTCGGCGTCATCGGTGCTGGCCAGATGGGGCTTGGGATCGCC
TTGGTAGCGGCTCAAAAGGCGCAGATACCCGTCACTCTGATCGATTCTTCCGACAAGGCTTTGGACAAGGGCCTT
GCATTCGCCGACAAGCTGCTGGCCAAGGACGTATCCAAGTCGAGGATAACACAAGAGCAGGCTGACAAGGCGAGA
TCTCTCCTTAAGCCCAGCACCAGCATCGAGGATCTGCGCTCTGTCGACTTCGTCATCGAGGCTGTGCCCGAGATA
CCCAAGCTCAAGTTTGAAATCTTTGGAAACCTGGCGAGAATCTGCCCCAAGCACGCCATCTTGGCGACCAACACG
TCGTCTATATCCATCACCCGCATTGCCGCCGCGACGACGAATAACCCTACCGACACGTCCGCCTCATCGCGCGTT
GTCTCGACGCACTTTATGAATCCCGTGCCTGTACAGAAGGGTGTCGAGATCATCAGCGGTCTTCAAACCAGTAAA
GAGACTGTTGAAACGGCTGTCGAATTTTGCAAAAGGATGGGCAAGATTGCATCCGTCTCGGCCGACTCGCCGGGG
TTTCTGGCCAACCGCATCCTCATGCCCTATATCAACGAGGCCATCATCTGCCTGGAAACGGGCGTCGGAGATCGG
GACTCCATCGATGCCATTATGAAGAACGGCACCAACGTTCCCATGGGTCCTCTCCAGCTTGCCGACTTTATCGGC
CTCGACACTTGCCAATCCATCATGAAGGTACTGCATGAAGAGACGGGCGACTCCAAGTACCGGCCCAGCATATTA
CTCGGCAAAATGGTTGACGCCGGCTGGGTGGGAAAGAAGAGCGGAAAAGGCTTCTACGACTATTAG
Transcript >Ophcf2|00602
ATGACGAGCTCGATTTTCCGGACTCAGGCCTTCAAGGCCGCACGCATAGCGTCTCAGGCGCGCAGCTTCAGCTGC
CTCTCGTCCAGGCAAGCCGCAGATGTCAACAGCCTCGGCGTCATCGGTGCTGGCCAGATGGGGCTTGGGATCGCC
TTGGTAGCGGCTCAAAAGGCGCAGATACCCGTCACTCTGATCGATTCTTCCGACAAGGCTTTGGACAAGGGCCTT
GCATTCGCCGACAAGCTGCTGGCCAAGGACGTATCCAAGTCGAGGATAACACAAGAGCAGGCTGACAAGGCGAGA
TCTCTCCTTAAGCCCAGCACCAGCATCGAGGATCTGCGCTCTGTCGACTTCGTCATCGAGGCTGTGCCCGAGATA
CCCAAGCTCAAGTTTGAAATCTTTGGAAACCTGGCGAGAATCTGCCCCAAGCACGCCATCTTGGCGACCAACACG
TCGTCTATATCCATCACCCGCATTGCCGCCGCGACGACGAATAACCCTACCGACACGTCCGCCTCATCGCGCGTT
GTCTCGACGCACTTTATGAATCCCGTGCCTGTACAGAAGGGTGTCGAGATCATCAGCGGTCTTCAAACCAGTAAA
GAGACTGTTGAAACGGCTGTCGAATTTTGCAAAAGGATGGGCAAGATTGCATCCGTCTCGGCCGACTCGCCGGGG
TTTCTGGCCAACCGCATCCTCATGCCCTATATCAACGAGGCCATCATCTGCCTGGAAACGGGCGTCGGAGATCGG
GACTCCATCGATGCCATTATGAAGAACGGCACCAACGTTCCCATGGGTCCTCTCCAGCTTGCCGACTTTATCGGC
CTCGACACTTGCCAATCCATCATGAAGGTACTGCATGAAGAGACGGGCGACTCCAAGTACCGGCCCAGCATATTA
CTCGGCAAAATGGTTGACGCCGGCTGGGTGGGAAAGAAGAGCGGAAAAGGCTTCTACGACTATTAG
Gene >Ophcf2|00602
ATGACGAGCTCGATTTTCCGGACTCAGGCCTTCAAGGCCGCACGCATAGCGTCTCAGGCGCGCAGCTTCAGCTGC
CTCTCGTCCAGGCAAGCCGCAGATGTCAACAGCCTCGGCGTCATCGGTGCTGGCCAGATGGTCTGTCCTCGCCGA
GCCGCACACCCCCGTCGCTTTGACTGATAGCTTGGCGGGGGGAATAGGGGCTTGGGATCGCCTTGGTAGCGGCTC
AAAAGGCGCAGATACCCGTCACTCTGATCGATTCTTCCGACAAGGCTTTGGACAAGGGCCTTGCATTCGCCGGTA
CAGCCGGCATCTCCACGGTCGAGTCCGCGACTGACGAGGGGTTCAGACAAGCTGCTGGCCAAGGACGTATCCAAG
TCGAGGATAACACAAGAGCAGGCTGACAAGGCGAGATCTCTCCTTAAGCCCAGCACCAGCATCGAGGATCTGCGC
TCTGTCGACTTCGTCATCGAGGCTGTGCCCGAGATACCCAAGCTCAAGTTTGAAATCTTTGGAAACCTGGCGAGA
ATCTGCCCCAAGCACGCCATCTTGGCGACCAACACGTCGTCTATATCCATCACCCGCATTGCCGCCGCGACGACG
AATAACCCTACCGACACGTCCGCCTCATCGCGCGTTGTCTCGACGCACTTTATGAATCCCGTGCCTGTACAGAAG
GGTGTCGAGATCATCAGCGGTCTTCAAACCAGTAAAGAGACTGTTGAAACGGCTGTCGAATTTTGCAAAAGGATG
GGCAAGATTGCATCCGTCTCGGCCGACTCGCCGGGGTTTCTGGCCAACCGCATCCTCATGCCCTATATCAACGAG
GCCATCATCTGCCTGGAAACGGGCGTCGGAGATCGGGACTCCATCGATGCCATTATGAAGAACGGCACCAACGTT
CCCATGGGTCCTCTCCAGCTTGCCGACTTTATCGGCCTCGACACTTGCCAATCCATCATGAAGGTACTGCATGAA
GAGACGGGCGACTCCAAGTACCGGCCCAGCATATTACTCGGCAAAATGGTTGACGCCGGCTGGGTGGGAAAGAAG
AGCGGAAAAGGCTTCTACGACTATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail