Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00588
Gene name
Locationscaffold_01:2311561..2315979
Strand+
Gene length (bp)4418
Transcript length (bp)4203
Coding sequence length (bp)4203
Protein length (aa) 1401

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 2.8E-96 1 228
PF17846 XRN_M Xrn1 helical domain 6.8E-95 276 675
PF18332 XRN1_D1 Exoribonuclease Xrn1 D1 domain 7.9E-71 726 914
PF18334 XRN1_D2_D3 Exoribonuclease Xrn1 D2/D3 domain 4.4E-33 918 1003
PF18194 Xrn1_D3 Exoribonuclease 1 Domain-3 4.1E-20 1084 1154
PF18129 SH3_12 Xrn1 SH3-like domain 5.5E-20 1161 1231

GO

GO Term Description Terminal node
GO:0004527 exonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.63 0.6823 0.0707 0.0188 0.1218 0.0058 0.0677 0.0393 0.0686 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2635
Ophiocordyceps australis map64 (Brazil) OphauB2|5531
Ophiocordyceps camponoti-floridani Ophcf2|00588 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7396
Ophiocordyceps kimflemingae Ophio5|7713
Ophiocordyceps subramaniannii Hirsu2|8404

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00588
MGVPKFFRWLSERYPAISQVIAENRIPEFDCLYLDMNGIIHNCTHKDAGEDATFRLSEEEMFIRIFNYIEHLFGK
IKPKQLFFMAIDGVAPRAKMNQQRSRRFRTALDAEKAREKAIKEGVAMPKEEPFDSNCITPGTVFMAKLSQQLRY
FVNKKISEDTEWQGCEVVLSGHDVPGEGEHKIMEYIRNAKAQPGYNPNVRHCLYGLDADLIMLGLLSHDPHFCLL
REEVTFGRASKTKSKELEHQSFYLLHLCIVREYLEMEFQELQKEGVLSFAFDLERVIDDFILMAFFVGNDFLPNL
PGLHINEGALANMFGVYKKVLPQCQGYINENGIINLARLRSLLEELSKLELLSFENDISDEKWFASKQNGTRQVA
NKSTTTERGSQGKSVVMTSFQRDLWKRKIRPHVSSRSKQPLNLGTSLKAADRKFVQDLAESMNLEWSTKEDENGD
RSLVLAFPSWPGEGDEGEDDDEGGLAAWRLIKRYDRAQVVDVTVDDAQNHYEKLYQDKYLAWKTKYYLQKFPEWP
SEKYDDEQTALCENYAQGLQWVLFYYYEGIASWPWFYGYHYAPLISDVVKGLGADFKFKKGQPLKPYEQLMGVLP
DRSKSIVPKVYHDLMTNPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIDEKRLLTAMASRNELLSDDEKGRNG
FGVPIKFTYSSDVCFVYPSSLPGTFHEINPCRCVENIFELPDVVGLEYLSGLTSGALLNIQALAGFPTLHHLPHT
AQLVENHRVNVFQAESKNPSLVVTLTDSDVRTRVETWKAKLGQRCYVNYPFLQEAKVMRVQDELFSYSLAENGKD
IITRNHDPKEIEAFRKEADYLENWYGKRLAITIGKVECLVHVHMLKGLIKTEEGALIKVYAENSSVRSAYASQTV
VEEVINEDERFIEKAALPIEEELPVETRAFFLGEYAYGRPLEIMGHANNKAEIVLSTLNTKEPPFAREVIQQAER
TNPYTPSFTVAKRLGMQPLVLSKITSSFQVTNLAGLKLNLGLNLKFEGKKLKVLGYSRKSKTGWEFSHLAIKLIA
DYMVAFPDFFAAIQREQQNSDIVETDLWPDPKMASQRIKDIVAWLKMQETGKFERVTLEAEQLDSDIVMTLAQVG
EKLLEAAGDTSVQRLRGVPRSAILKPVDAELVLGNQKFSLGDRVTFAAAAGKVPIATRGTVVGISRTATALLLDV
VWDTSFMSGTTLGERAPMFRGQTVSSTSVLNTTNRQVISASYKSQQRRSVPPGPRPAGMPQYMNGPVPPPLRGGW
RGAAIAGGDRWADGNAPTLLHSSLVYRSSSSGEPSNSTGPRQGRGPNQVNGRGERRGRGRGSSDEFRRAASAQAA
APKYGNVPPPASLDNSRGGRGGRSRGGRGSGFYGRGRGRGGVNGDAKLDL*
Coding >Ophcf2|00588
ATGGGTGTTCCCAAGTTCTTCCGATGGCTCTCGGAGCGCTATCCTGCCATCTCCCAAGTCATTGCGGAGAACCGG
ATACCCGAATTCGACTGTCTCTATCTCGATATGAACGGAATCATCCATAACTGCACTCATAAGGATGCTGGCGAG
GATGCGACCTTTAGGCTCAGCGAGGAGGAAATGTTCATCCGCATCTTCAACTACATCGAGCACCTTTTCGGAAAG
ATAAAGCCTAAGCAACTCTTCTTCATGGCTATTGATGGCGTGGCGCCTCGAGCCAAGATGAACCAGCAGAGGTCG
CGTCGCTTCAGGACAGCTCTCGATGCCGAAAAGGCTCGCGAAAAGGCCATCAAGGAGGGCGTCGCGATGCCAAAA
GAAGAGCCCTTTGACAGCAATTGCATCACGCCAGGAACCGTCTTCATGGCCAAGCTGTCGCAACAACTGCGCTAC
TTCGTCAATAAGAAGATATCGGAAGATACCGAGTGGCAGGGATGTGAGGTGGTACTGTCCGGCCACGACGTACCG
GGTGAAGGAGAACATAAGATCATGGAGTACATCCGCAACGCAAAGGCACAACCAGGCTACAACCCCAACGTGCGG
CACTGCCTCTACGGCTTGGACGCCGATCTAATCATGCTGGGCTTGCTCAGCCACGATCCGCACTTTTGCCTCCTG
CGAGAAGAGGTGACGTTCGGGCGGGCCTCCAAGACCAAGTCTAAGGAGCTCGAGCACCAAAGTTTCTACCTTCTT
CACCTCTGTATCGTCAGAGAATACTTGGAAATGGAATTCCAGGAGTTGCAAAAGGAAGGTGTGCTAAGTTTCGCA
TTCGATCTCGAGCGGGTCATTGATGATTTCATCCTGATGGCGTTTTTTGTCGGCAACGACTTTCTTCCCAACCTC
CCTGGCCTTCACATCAACGAAGGTGCTCTGGCCAACATGTTTGGCGTCTACAAAAAAGTTCTTCCCCAGTGCCAG
GGATACATCAACGAAAACGGCATCATCAACTTGGCCCGCCTGCGCAGCCTCCTTGAGGAATTAAGCAAGCTTGAG
CTGCTTTCCTTCGAAAACGACATCTCGGACGAGAAGTGGTTCGCGTCAAAGCAGAACGGAACGAGGCAGGTGGCG
AACAAGAGTACGACGACAGAAAGGGGCTCTCAGGGCAAATCTGTCGTCATGACGTCGTTCCAGCGGGATCTGTGG
AAGCGAAAGATTCGACCCCACGTCTCCAGTCGATCGAAACAGCCGTTGAACCTCGGCACCAGTCTCAAGGCAGCA
GACCGCAAGTTCGTCCAGGATCTCGCTGAGTCGATGAACTTGGAGTGGTCAACCAAGGAGGATGAGAACGGCGAC
CGATCCCTAGTACTGGCTTTCCCATCGTGGCCGGGCGAAGGAGACGAAGGAGAAGATGATGATGAGGGCGGGCTG
GCGGCCTGGCGTCTCATCAAGCGCTACGACAGAGCTCAAGTCGTCGATGTGACGGTTGATGATGCGCAGAATCAC
TATGAAAAGTTGTATCAGGACAAATACCTGGCGTGGAAGACCAAGTACTATCTTCAGAAGTTTCCCGAATGGCCT
TCGGAGAAGTACGACGACGAGCAGACGGCGCTCTGCGAGAATTACGCTCAGGGCCTCCAGTGGGTTCTCTTCTAC
TACTACGAGGGTATAGCATCATGGCCGTGGTTCTACGGTTATCACTATGCGCCGCTCATATCAGACGTCGTCAAG
GGCCTCGGTGCCGACTTCAAGTTCAAGAAGGGCCAGCCACTCAAGCCTTACGAGCAACTGATGGGAGTCTTGCCG
GACCGCAGCAAAAGTATCGTTCCCAAGGTGTATCACGATCTGATGACCAACCCGGACTCGCCCATCATCGACTTT
TACCCCCGAGACTTCGAGCTGGACATGAACGGCAAGAAAATGGAATGGGAGGCCGTCGTCAAGATCCCCTTCATC
GACGAGAAGCGTCTTCTGACCGCCATGGCTTCGCGGAACGAGCTTCTCAGCGACGACGAAAAGGGACGGAATGGG
TTTGGGGTTCCCATCAAGTTTACGTACTCCTCGGATGTGTGCTTCGTATACCCTTCATCGCTGCCGGGCACCTTT
CACGAAATCAACCCCTGTCGTTGCGTCGAAAACATCTTTGAGCTGCCCGACGTCGTGGGCCTCGAATACCTGTCC
GGCCTGACGTCTGGCGCCTTGCTCAACATTCAGGCACTGGCAGGGTTTCCTACGCTGCATCATCTACCGCACACG
GCGCAGCTGGTCGAGAATCACAGAGTCAACGTCTTCCAGGCCGAAAGCAAGAACCCGAGTCTCGTCGTCACATTG
ACTGATAGCGACGTACGGACCAGAGTTGAGACTTGGAAGGCGAAGCTCGGTCAGCGCTGTTATGTGAATTATCCT
TTCCTGCAGGAAGCCAAGGTAATGCGTGTTCAAGACGAGCTCTTCTCGTATTCGCTGGCAGAGAACGGAAAGGAC
ATCATCACAAGAAACCATGACCCGAAAGAGATCGAAGCGTTTAGGAAGGAAGCAGATTACCTGGAGAACTGGTAT
GGGAAGCGGCTGGCAATCACCATCGGCAAAGTGGAATGTCTCGTTCATGTGCACATGCTCAAGGGCCTGATCAAG
ACGGAGGAGGGGGCGCTGATCAAAGTCTACGCCGAAAACTCGAGTGTGCGAAGTGCATACGCATCGCAGACAGTC
GTCGAAGAAGTCATCAACGAGGATGAGCGCTTCATCGAAAAGGCTGCCCTGCCGATCGAAGAAGAGCTGCCCGTG
GAGACGCGAGCGTTCTTTCTCGGCGAATACGCATACGGACGTCCCCTGGAGATCATGGGCCACGCCAACAACAAG
GCGGAAATTGTGCTCTCGACGCTCAACACCAAGGAGCCGCCGTTTGCCAGGGAAGTCATCCAGCAGGCGGAGCGG
ACGAATCCGTACACGCCTTCTTTTACTGTTGCCAAACGGTTGGGCATGCAACCTCTGGTGTTGAGCAAGATCACT
TCGTCGTTTCAAGTCACCAATCTGGCCGGGCTGAAGCTGAATTTGGGCCTGAACCTCAAATTCGAGGGCAAGAAG
CTCAAGGTCTTGGGCTACTCTCGGAAGTCGAAGACGGGCTGGGAATTCAGTCATCTGGCCATCAAGCTGATCGCC
GACTACATGGTCGCGTTTCCAGACTTCTTTGCTGCGATCCAGAGGGAGCAGCAGAACTCGGACATTGTTGAGACG
GACCTGTGGCCGGATCCGAAGATGGCTTCGCAGCGTATCAAGGACATTGTGGCCTGGCTGAAGATGCAGGAGACG
GGCAAGTTTGAGAGGGTTACGCTAGAGGCCGAACAGCTCGACTCGGACATCGTCATGACCCTGGCCCAGGTCGGC
GAGAAGCTTCTAGAGGCTGCCGGCGACACGTCGGTCCAGAGGCTTCGCGGCGTGCCTCGATCGGCCATTCTCAAA
CCGGTAGATGCCGAGCTCGTGCTGGGCAACCAGAAGTTCAGCCTCGGCGACCGAGTCACGTTCGCTGCGGCCGCG
GGTAAAGTGCCCATCGCCACACGAGGAACGGTAGTGGGCATCAGTCGAACTGCGACGGCGCTACTCCTGGACGTC
GTCTGGGACACGTCGTTTATGAGCGGGACGACGCTGGGCGAGCGAGCACCCATGTTCAGGGGCCAGACGGTCTCG
TCGACGTCGGTGCTCAACACGACGAACAGGCAGGTCATCTCGGCCTCGTACAAGTCGCAACAGCGGCGCTCCGTT
CCGCCGGGGCCGAGGCCGGCCGGCATGCCGCAGTACATGAACGGTCCGGTGCCGCCTCCGCTGCGAGGCGGGTGG
CGCGGAGCGGCCATTGCTGGTGGCGACCGATGGGCCGATGGCAACGCTCCGACCTTGTTGCACAGCTCGCTCGTG
TATCGGAGCAGCTCTAGCGGTGAGCCTTCAAATTCGACGGGACCGAGACAGGGACGAGGGCCGAATCAAGTCAAC
GGAAGAGGTGAACGGCGAGGACGTGGTCGCGGAAGTTCGGACGAGTTCCGACGAGCCGCTTCTGCTCAGGCGGCC
GCGCCTAAATACGGAAACGTCCCTCCGCCTGCCTCCCTGGACAATTCACGCGGTGGCCGTGGTGGCCGAAGTCGT
GGCGGCCGAGGCTCTGGGTTTTACGGAAGAGGGCGCGGCCGAGGGGGCGTCAATGGTGATGCCAAGTTGGATCTA
TGA
Transcript >Ophcf2|00588
ATGGGTGTTCCCAAGTTCTTCCGATGGCTCTCGGAGCGCTATCCTGCCATCTCCCAAGTCATTGCGGAGAACCGG
ATACCCGAATTCGACTGTCTCTATCTCGATATGAACGGAATCATCCATAACTGCACTCATAAGGATGCTGGCGAG
GATGCGACCTTTAGGCTCAGCGAGGAGGAAATGTTCATCCGCATCTTCAACTACATCGAGCACCTTTTCGGAAAG
ATAAAGCCTAAGCAACTCTTCTTCATGGCTATTGATGGCGTGGCGCCTCGAGCCAAGATGAACCAGCAGAGGTCG
CGTCGCTTCAGGACAGCTCTCGATGCCGAAAAGGCTCGCGAAAAGGCCATCAAGGAGGGCGTCGCGATGCCAAAA
GAAGAGCCCTTTGACAGCAATTGCATCACGCCAGGAACCGTCTTCATGGCCAAGCTGTCGCAACAACTGCGCTAC
TTCGTCAATAAGAAGATATCGGAAGATACCGAGTGGCAGGGATGTGAGGTGGTACTGTCCGGCCACGACGTACCG
GGTGAAGGAGAACATAAGATCATGGAGTACATCCGCAACGCAAAGGCACAACCAGGCTACAACCCCAACGTGCGG
CACTGCCTCTACGGCTTGGACGCCGATCTAATCATGCTGGGCTTGCTCAGCCACGATCCGCACTTTTGCCTCCTG
CGAGAAGAGGTGACGTTCGGGCGGGCCTCCAAGACCAAGTCTAAGGAGCTCGAGCACCAAAGTTTCTACCTTCTT
CACCTCTGTATCGTCAGAGAATACTTGGAAATGGAATTCCAGGAGTTGCAAAAGGAAGGTGTGCTAAGTTTCGCA
TTCGATCTCGAGCGGGTCATTGATGATTTCATCCTGATGGCGTTTTTTGTCGGCAACGACTTTCTTCCCAACCTC
CCTGGCCTTCACATCAACGAAGGTGCTCTGGCCAACATGTTTGGCGTCTACAAAAAAGTTCTTCCCCAGTGCCAG
GGATACATCAACGAAAACGGCATCATCAACTTGGCCCGCCTGCGCAGCCTCCTTGAGGAATTAAGCAAGCTTGAG
CTGCTTTCCTTCGAAAACGACATCTCGGACGAGAAGTGGTTCGCGTCAAAGCAGAACGGAACGAGGCAGGTGGCG
AACAAGAGTACGACGACAGAAAGGGGCTCTCAGGGCAAATCTGTCGTCATGACGTCGTTCCAGCGGGATCTGTGG
AAGCGAAAGATTCGACCCCACGTCTCCAGTCGATCGAAACAGCCGTTGAACCTCGGCACCAGTCTCAAGGCAGCA
GACCGCAAGTTCGTCCAGGATCTCGCTGAGTCGATGAACTTGGAGTGGTCAACCAAGGAGGATGAGAACGGCGAC
CGATCCCTAGTACTGGCTTTCCCATCGTGGCCGGGCGAAGGAGACGAAGGAGAAGATGATGATGAGGGCGGGCTG
GCGGCCTGGCGTCTCATCAAGCGCTACGACAGAGCTCAAGTCGTCGATGTGACGGTTGATGATGCGCAGAATCAC
TATGAAAAGTTGTATCAGGACAAATACCTGGCGTGGAAGACCAAGTACTATCTTCAGAAGTTTCCCGAATGGCCT
TCGGAGAAGTACGACGACGAGCAGACGGCGCTCTGCGAGAATTACGCTCAGGGCCTCCAGTGGGTTCTCTTCTAC
TACTACGAGGGTATAGCATCATGGCCGTGGTTCTACGGTTATCACTATGCGCCGCTCATATCAGACGTCGTCAAG
GGCCTCGGTGCCGACTTCAAGTTCAAGAAGGGCCAGCCACTCAAGCCTTACGAGCAACTGATGGGAGTCTTGCCG
GACCGCAGCAAAAGTATCGTTCCCAAGGTGTATCACGATCTGATGACCAACCCGGACTCGCCCATCATCGACTTT
TACCCCCGAGACTTCGAGCTGGACATGAACGGCAAGAAAATGGAATGGGAGGCCGTCGTCAAGATCCCCTTCATC
GACGAGAAGCGTCTTCTGACCGCCATGGCTTCGCGGAACGAGCTTCTCAGCGACGACGAAAAGGGACGGAATGGG
TTTGGGGTTCCCATCAAGTTTACGTACTCCTCGGATGTGTGCTTCGTATACCCTTCATCGCTGCCGGGCACCTTT
CACGAAATCAACCCCTGTCGTTGCGTCGAAAACATCTTTGAGCTGCCCGACGTCGTGGGCCTCGAATACCTGTCC
GGCCTGACGTCTGGCGCCTTGCTCAACATTCAGGCACTGGCAGGGTTTCCTACGCTGCATCATCTACCGCACACG
GCGCAGCTGGTCGAGAATCACAGAGTCAACGTCTTCCAGGCCGAAAGCAAGAACCCGAGTCTCGTCGTCACATTG
ACTGATAGCGACGTACGGACCAGAGTTGAGACTTGGAAGGCGAAGCTCGGTCAGCGCTGTTATGTGAATTATCCT
TTCCTGCAGGAAGCCAAGGTAATGCGTGTTCAAGACGAGCTCTTCTCGTATTCGCTGGCAGAGAACGGAAAGGAC
ATCATCACAAGAAACCATGACCCGAAAGAGATCGAAGCGTTTAGGAAGGAAGCAGATTACCTGGAGAACTGGTAT
GGGAAGCGGCTGGCAATCACCATCGGCAAAGTGGAATGTCTCGTTCATGTGCACATGCTCAAGGGCCTGATCAAG
ACGGAGGAGGGGGCGCTGATCAAAGTCTACGCCGAAAACTCGAGTGTGCGAAGTGCATACGCATCGCAGACAGTC
GTCGAAGAAGTCATCAACGAGGATGAGCGCTTCATCGAAAAGGCTGCCCTGCCGATCGAAGAAGAGCTGCCCGTG
GAGACGCGAGCGTTCTTTCTCGGCGAATACGCATACGGACGTCCCCTGGAGATCATGGGCCACGCCAACAACAAG
GCGGAAATTGTGCTCTCGACGCTCAACACCAAGGAGCCGCCGTTTGCCAGGGAAGTCATCCAGCAGGCGGAGCGG
ACGAATCCGTACACGCCTTCTTTTACTGTTGCCAAACGGTTGGGCATGCAACCTCTGGTGTTGAGCAAGATCACT
TCGTCGTTTCAAGTCACCAATCTGGCCGGGCTGAAGCTGAATTTGGGCCTGAACCTCAAATTCGAGGGCAAGAAG
CTCAAGGTCTTGGGCTACTCTCGGAAGTCGAAGACGGGCTGGGAATTCAGTCATCTGGCCATCAAGCTGATCGCC
GACTACATGGTCGCGTTTCCAGACTTCTTTGCTGCGATCCAGAGGGAGCAGCAGAACTCGGACATTGTTGAGACG
GACCTGTGGCCGGATCCGAAGATGGCTTCGCAGCGTATCAAGGACATTGTGGCCTGGCTGAAGATGCAGGAGACG
GGCAAGTTTGAGAGGGTTACGCTAGAGGCCGAACAGCTCGACTCGGACATCGTCATGACCCTGGCCCAGGTCGGC
GAGAAGCTTCTAGAGGCTGCCGGCGACACGTCGGTCCAGAGGCTTCGCGGCGTGCCTCGATCGGCCATTCTCAAA
CCGGTAGATGCCGAGCTCGTGCTGGGCAACCAGAAGTTCAGCCTCGGCGACCGAGTCACGTTCGCTGCGGCCGCG
GGTAAAGTGCCCATCGCCACACGAGGAACGGTAGTGGGCATCAGTCGAACTGCGACGGCGCTACTCCTGGACGTC
GTCTGGGACACGTCGTTTATGAGCGGGACGACGCTGGGCGAGCGAGCACCCATGTTCAGGGGCCAGACGGTCTCG
TCGACGTCGGTGCTCAACACGACGAACAGGCAGGTCATCTCGGCCTCGTACAAGTCGCAACAGCGGCGCTCCGTT
CCGCCGGGGCCGAGGCCGGCCGGCATGCCGCAGTACATGAACGGTCCGGTGCCGCCTCCGCTGCGAGGCGGGTGG
CGCGGAGCGGCCATTGCTGGTGGCGACCGATGGGCCGATGGCAACGCTCCGACCTTGTTGCACAGCTCGCTCGTG
TATCGGAGCAGCTCTAGCGGTGAGCCTTCAAATTCGACGGGACCGAGACAGGGACGAGGGCCGAATCAAGTCAAC
GGAAGAGGTGAACGGCGAGGACGTGGTCGCGGAAGTTCGGACGAGTTCCGACGAGCCGCTTCTGCTCAGGCGGCC
GCGCCTAAATACGGAAACGTCCCTCCGCCTGCCTCCCTGGACAATTCACGCGGTGGCCGTGGTGGCCGAAGTCGT
GGCGGCCGAGGCTCTGGGTTTTACGGAAGAGGGCGCGGCCGAGGGGGCGTCAATGGTGATGCCAAGTTGGATCTA
TGA
Gene >Ophcf2|00588
ATGGGGTATGACGTCCCCTCGCACTTTTCGCTTGTTCAAAGGCTTATTCTCATCGCAGTGTTCCCAAGTTCTTCC
GATGGCTCTCGGAGCGCTATCCTGCCATCTCCCAAGTCATTGCGGAGAACCGGATACCCGAATTCGACTGTCTCT
ATGTGCAATCAACCCTCCTTTGCACCGTCGCCCGCCCACTGACTTGCTCCTGCAGCTCGATATGAACGGAATCAT
CCATAACTGCACTCATAAGGATGCTGGCGAGGATGCGACCTTTAGGCTCAGCGAGGAGGAAATGTTCATCCGCAT
CTTCAACTACATCGAGCACCTTTTCGGAAAGATAAAGCCTAAGCAACTCTTCTTCATGGCTATTGATGGCGTGGC
GCCTCGAGCCAAGATGAACCAGCAGAGGTCGCGTCGCTTCAGGACAGCTCTCGATGCCGAAAAGGCTCGCGAAAA
GGCCATCAAGGAGGGCGTCGCGATGCCAAAAGAAGAGCCCTTTGACAGCAATTGCATCACGCCAGGCAAGTTGGC
GGCATGCGGTCAACGAGGAAGCGGCACACGCTGACCGTCTTGCCCAGGAACCGTCTTCATGGCCAAGCTGTCGCA
ACAACTGCGCTACTTCGTCAATAAGAAGATATCGGAAGATACCGAGTGGCAGGGATGTGAGGTGGTACTGTCCGG
CCACGACGTACCGGGTGAAGGAGAACATAAGATCATGGAGTACATCCGCAACGCAAAGGCACAACCAGGCTACAA
CCCCAACGTGCGGCACTGCCTCTACGGCTTGGACGCCGATCTAATCATGCTGGGCTTGCTCAGCCACGATCCGCA
CTTTTGCCTCCTGCGAGAAGAGGTGACGTTCGGGCGGGCCTCCAAGACCAAGTCTAAGGAGCTCGAGCACCAAAG
TTTCTACCTTCTTCACCTCTGTATCGTCAGAGAATACTTGGAAATGGAATTCCAGGAGTTGCAAAAGGAAGGTGT
GCTAAGTTTCGCATTCGATCTCGAGCGGGTCATTGATGATTTCATCCTGATGGCGTTTTTTGTCGGCAACGACTT
TCTTCCCAACCTCCCTGGCCTTCACATCAACGAAGGTGCTCTGGCCAACATGTTTGGCGTCTACAAAAAAGTTCT
TCCCCAGTGCCAGGGATACATCAACGAAAACGGCATCATCAACTTGGCCCGCCTGCGCAGCCTCCTTGAGGAATT
AAGCAAGCTTGAGCTGCTTTCCTTCGAAAACGACATCTCGGACGAGAAGTGGTTCGCGTCAAAGCAGAACGGAAC
GAGGCAGGTGGCGAACAAGAGTACGACGACAGAAAGGGGCTCTCAGGGCAAATCTGTCGTCATGACGTCGTTCCA
GCGGGATCTGTGGAAGCGAAAGATTCGACCCCACGTCTCCAGTCGATCGAAACAGCCGTTGAACCTCGGCACCAG
TCTCAAGGCAGCAGACCGCAAGTTCGTCCAGGATCTCGCTGAGTCGATGAACTTGGAGTGGTCAACCAAGGAGGA
TGAGAACGGCGACCGATCCCTAGTACTGGCTTTCCCATCGTGGCCGGGCGAAGGAGACGAAGGAGAAGATGATGA
TGAGGGCGGGCTGGCGGCCTGGCGTCTCATCAAGCGCTACGACAGAGCTCAAGTCGTCGATGTGACGGTTGATGA
TGCGCAGAATCACTATGAAAAGTTGTATCAGGACAAATACCTGGCGTGGAAGACCAAGTACTATCTTCAGAAGTT
TCCCGAATGGCCTTCGGAGAAGTACGACGACGAGCAGACGGCGCTCTGCGAGAATTACGCTCAGGGCCTCCAGTG
GGTTCTCTTCTACTACTACGAGGGTATAGCATCATGGCCGTGGTTCTACGGTTATCACTATGCGCCGCTCATATC
AGGTTCGTCAGCCTCGAGCTGCTCAATCGCCGCAGACTAATCCTGGTGTTTCAGACGTCGTCAAGGGCCTCGGTG
CCGACTTCAAGTTCAAGAAGGGCCAGCCACTCAAGCCTTACGAGCAACTGATGGGAGTCTTGCCGGACCGCAGCA
AAAGTATCGTTCCCAAGGTGTATCACGATCTGATGACCAACCCGGACTCGCCCATCATCGACTTTTACCCCCGAG
ACTTCGAGCTGGACATGAACGGCAAGAAAATGGAATGGGAGGCCGTCGTCAAGATCCCCTTCATCGACGAGAAGC
GTCTTCTGACCGCCATGGCTTCGCGGAACGAGCTTCTCAGCGACGACGAAAAGGGACGGAATGGGTTTGGGGTTC
CCATCAAGTTTACGTACTCCTCGGATGTGTGCTTCGTATACCCTTCATCGCTGCCGGGCACCTTTCACGAAATCA
ACCCCTGTCGTTGCGTCGAAAACATCTTTGAGCTGCCCGACGTCGTGGGCCTCGAATACCTGTCCGGCCTGACGT
CTGGCGCCTTGCTCAACATTCAGGCACTGGCAGGGTTTCCTACGCTGCATCATCTACCGCACACGGCGCAGCTGG
TCGAGAATCACAGAGTCAACGTCTTCCAGGCCGAAAGCAAGAACCCGAGTCTCGTCGTCACATTGACTGATAGCG
ACGTACGGACCAGAGTTGAGACTTGGAAGGCGAAGCTCGGTCAGCGCTGTTATGTGAATTATCCTTTCCTGCAGG
AAGCCAAGGTAATGCGTGTTCAAGACGAGCTCTTCTCGTATTCGCTGGCAGAGAACGGAAAGGACATCATCACAA
GAAACCATGACCCGAAAGAGATCGAAGCGTTTAGGAAGGAAGCAGATTACCTGGAGAACTGGTATGGGAAGCGGC
TGGCAATCACCATCGGCAAAGTGGAATGTCTCGTTCATGTGCACATGCTCAAGGGCCTGATCAAGACGGAGGAGG
GGGCGCTGATCAAAGTCTACGCCGAAAACTCGAGTGTGCGAAGTGCATACGCATCGCAGACAGTCGTCGAAGAAG
TCATCAACGAGGATGAGCGCTTCATCGAAAAGGCTGCCCTGCCGATCGAAGAAGAGCTGCCCGTGGAGACGCGAG
CGTTCTTTCTCGGCGAATACGCATACGGACGTCCCCTGGAGATCATGGGCCACGCCAACAACAAGGCGGAAATTG
TGCTCTCGACGCTCAACACCAAGGAGCCGCCGTTTGCCAGGGAAGTCATCCAGCAGGCGGAGCGGACGAATCCGT
ACACGCCTTCTTTTACTGTTGCCAAACGGTTGGGCATGCAACCTCTGGTGTTGAGCAAGATCACTTCGTCGTTTC
AAGTCACCAATCTGGCCGGGCTGAAGCTGAATTTGGGCCTGAACCTCAAATTCGAGGGCAAGAAGCTCAAGGTCT
TGGGCTACTCTCGGAAGTCGAAGACGGGCTGGGAATTCAGTCATCTGGCCATCAAGCTGATCGCCGACTACATGG
TCGCGTTTCCAGACTTCTTTGCTGCGATCCAGAGGGAGCAGCAGAACTCGGACATTGTTGAGACGGACCTGTGGC
CGGATCCGAAGATGGCTTCGCAGCGTATCAAGGACATTGTGGCCTGGCTGAAGATGCAGGAGACGGGCAAGTTTG
AGAGGGTTACGCTAGAGGCCGAACAGCTCGACTCGGACATCGTCATGACCCTGGCCCAGGTCGGCGAGAAGCTTC
TAGAGGCTGCCGGCGACACGTCGGTCCAGAGGCTTCGCGGCGTGCCTCGATCGGCCATTCTCAAACCGGTAGATG
CCGAGCTCGTGCTGGGCAACCAGAAGTTCAGCCTCGGCGACCGAGTCACGTTCGCTGCGGCCGCGGGTAAAGTGC
CCATCGCCACACGAGGAACGGTAGTGGGCATCAGTCGAACTGCGACGGCGCTACTCCTGGACGTCGTCTGGGACA
CGTCGTTTATGAGCGGGACGACGCTGGGCGAGCGAGCACCCATGTTCAGGGGCCAGACGGTCTCGTCGACGTCGG
TGCTCAACACGACGAACAGGCAGGTCATCTCGGCCTCGTACAAGTCGCAACAGCGGCGCTCCGTTCCGCCGGGGC
CGAGGCCGGCCGGCATGCCGCAGTACATGAACGGTCCGGTGCCGCCTCCGCTGCGAGGCGGGTGGCGCGGAGCGG
CCATTGCTGGTGGCGACCGATGGGCCGATGGCAACGCTCCGACCTTGTTGCACAGCTCGCTCGTGTATCGGAGCA
GCTCTAGCGGTGAGCCTTCAAATTCGACGGGACCGAGACAGGGACGAGGGCCGAATCAAGTCAACGGAAGAGGTG
AACGGCGAGGACGTGGTCGCGGAAGTTCGGACGAGTTCCGACGAGCCGCTTCTGCTCAGGCGGCCGCGCCTAAAT
ACGGAAACGTCCCTCCGCCTGCCTCCCTGGACAATTCACGCGGTGGCCGTGGTGGCCGAAGTCGTGGCGGCCGAG
GCTCTGGGTTTTACGGAAGAGGGCGCGGCCGAGGGGGCGTCAATGGTGATGCCAAGTTGGATCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail