Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00585
Gene name
Locationscaffold_01:2303385..2305422
Strand+
Gene length (bp)2037
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 5.7E-11 350 377
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 4.3E-07 430 459
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.9E-08 255 322
PF00929 RNase_T Exonuclease 2.6E-06 19 133

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7165 0.6006 0.0231 0.034 0.0822 0.0044 0.1976 0.1728 0.1271 0.0049

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2667
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2638
Ophiocordyceps australis map64 (Brazil) OphauB2|5534
Ophiocordyceps camponoti-floridani Ophcf2|00585 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1023
Ophiocordyceps kimflemingae Ophio5|7710
Ophiocordyceps subramaniannii Hirsu2|4131

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00585
MSSQPQLNIDRYVVIHVATTCDEHGVYVTKDSAEVIELGWILLDANSLEEITHESVLVKPVNTPITPLCTSLTTL
TWEHVRNAGTFRDAISRFDTFATEYLTTKNLDFVFVTLDAWDLRVQLPREARDKAVVLPPYLQHSRTFDLRTEYQ
RWQQHHPESLPFGPSMLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLARVLRGLIRKSQPP
QDHPDVLTRPMDARADVRAFLSERSKVLHMSGLPHDTTQSELESWFTQFGGRPIAFWTLRTPEQHKPTGTGFAVF
SSHEEAAESLCMNGRALNEKAIEVSPSSSRVLDRAQDILTPFPPSKNRPRPGDWTCPSCGFSNFQRRTACFRCSF
PAMGPGPGGEMGGGGGGYGYNYGPPTMMPPPPHGGHHGPMGHGGRMGGGGVVPFRAGDWKCGNEVCGYHNFAKNV
CCLRCGASRAGAAVVADSGYPSPMDNASQYSMSQGSMAGTPGPGPFGSGNSFASGGAYNQHFGGPPSHFLPSGLG
GGAGTYPSSLNVQAFGSGPGSHPAGPFDSRAAEAAFQSATNGPASAGPGPSNNFYNSSNNGENDPFAFLSSGISG
LSVSGGDSRQNGGGAPPSKSPA*
Coding >Ophcf2|00585
ATGTCTTCCCAGCCTCAGCTCAACATCGACCGCTACGTCGTCATTCATGTGGCCACGACATGCGACGAACACGGC
GTCTACGTCACAAAGGACTCGGCCGAGGTCATTGAACTCGGCTGGATCCTCCTTGATGCCAACTCCCTCGAGGAG
ATCACCCACGAGAGTGTCCTCGTGAAGCCAGTCAACACGCCCATCACTCCGCTCTGCACAAGCTTGACGACGCTT
ACCTGGGAGCACGTCCGAAACGCCGGCACCTTCAGAGACGCCATCTCTCGATTCGATACATTCGCTACCGAATAT
CTGACCACCAAGAATCTCGACTTCGTATTCGTTACCCTTGATGCCTGGGACCTCCGCGTCCAGCTTCCCCGGGAA
GCTCGCGACAAGGCCGTCGTCCTCCCCCCGTATTTGCAGCATTCGCGCACCTTTGACCTGCGCACCGAATACCAG
CGCTGGCAGCAGCATCACCCCGAGTCCCTTCCCTTTGGACCTTCGATGCTGTCCAACATCTGTGCCGCTCTCGAG
GTTGAGCCGGTGCAATCGAGCGCCCCCATTAAGCATAACCTGCCCTTTCACCTGCAGGCCCTGGCTCCCGCGTCC
CCGCGTCGCGCCATGGAAGAGGCCATTACCCTGGCCCGCGTCCTCCGAGGCCTGATTCGGAAGTCTCAGCCTCCT
CAGGACCACCCCGACGTCCTCACCAGGCCCATGGACGCCAGAGCCGACGTCAGAGCCTTTTTGTCAGAGAGGAGC
AAGGTGCTCCACATGTCAGGGCTACCGCACGACACCACTCAGTCGGAGCTTGAGAGTTGGTTCACCCAGTTTGGC
GGACGTCCCATTGCCTTTTGGACGCTACGCACGCCGGAACAGCACAAGCCCACCGGCACCGGATTCGCCGTCTTC
TCCTCTCACGAAGAGGCGGCCGAGAGCCTCTGCATGAACGGACGTGCCTTGAACGAAAAGGCCATCGAGGTGTCA
CCGTCCTCGAGCCGCGTTCTTGATAGAGCTCAGGACATCCTGACGCCGTTCCCGCCTAGCAAGAACCGACCACGG
CCAGGCGATTGGACCTGCCCCTCGTGCGGCTTCTCCAACTTCCAAAGACGGACTGCCTGCTTCCGATGCTCGTTC
CCGGCCATGGGCCCCGGTCCCGGAGGTGAGATGGGCGGCGGCGGCGGCGGATACGGCTACAACTACGGCCCGCCT
ACCATGATGCCACCGCCTCCCCACGGTGGACATCACGGCCCTATGGGTCATGGCGGTCGTATGGGAGGTGGCGGC
GTCGTGCCCTTCCGCGCCGGCGACTGGAAGTGCGGCAATGAAGTGTGCGGCTACCACAACTTCGCCAAGAACGTC
TGCTGTCTTCGATGCGGCGCCAGTCGTGCCGGAGCGGCCGTCGTCGCCGACTCGGGCTACCCGTCTCCCATGGAC
AACGCGTCGCAGTACAGCATGAGCCAGGGCTCCATGGCTGGCACCCCGGGTCCCGGGCCGTTTGGTTCTGGCAAC
TCGTTTGCTTCTGGCGGCGCCTATAATCAGCACTTTGGCGGTCCGCCGAGCCATTTCTTGCCTTCGGGCCTCGGA
GGCGGTGCGGGGACGTATCCGAGTTCTCTCAACGTCCAGGCTTTCGGATCCGGACCCGGCTCGCACCCGGCCGGA
CCCTTTGACAGCCGGGCGGCAGAGGCCGCTTTCCAGTCGGCTACCAATGGACCTGCATCAGCCGGCCCGGGTCCT
TCGAATAATTTCTACAACAGCAGCAATAACGGTGAAAACGACCCTTTCGCATTCCTCTCGAGCGGTATCAGCGGC
CTCTCCGTCAGCGGTGGTGACTCTCGACAGAACGGCGGAGGCGCCCCCCCGAGCAAGTCGCCTGCCTAA
Transcript >Ophcf2|00585
ATGTCTTCCCAGCCTCAGCTCAACATCGACCGCTACGTCGTCATTCATGTGGCCACGACATGCGACGAACACGGC
GTCTACGTCACAAAGGACTCGGCCGAGGTCATTGAACTCGGCTGGATCCTCCTTGATGCCAACTCCCTCGAGGAG
ATCACCCACGAGAGTGTCCTCGTGAAGCCAGTCAACACGCCCATCACTCCGCTCTGCACAAGCTTGACGACGCTT
ACCTGGGAGCACGTCCGAAACGCCGGCACCTTCAGAGACGCCATCTCTCGATTCGATACATTCGCTACCGAATAT
CTGACCACCAAGAATCTCGACTTCGTATTCGTTACCCTTGATGCCTGGGACCTCCGCGTCCAGCTTCCCCGGGAA
GCTCGCGACAAGGCCGTCGTCCTCCCCCCGTATTTGCAGCATTCGCGCACCTTTGACCTGCGCACCGAATACCAG
CGCTGGCAGCAGCATCACCCCGAGTCCCTTCCCTTTGGACCTTCGATGCTGTCCAACATCTGTGCCGCTCTCGAG
GTTGAGCCGGTGCAATCGAGCGCCCCCATTAAGCATAACCTGCCCTTTCACCTGCAGGCCCTGGCTCCCGCGTCC
CCGCGTCGCGCCATGGAAGAGGCCATTACCCTGGCCCGCGTCCTCCGAGGCCTGATTCGGAAGTCTCAGCCTCCT
CAGGACCACCCCGACGTCCTCACCAGGCCCATGGACGCCAGAGCCGACGTCAGAGCCTTTTTGTCAGAGAGGAGC
AAGGTGCTCCACATGTCAGGGCTACCGCACGACACCACTCAGTCGGAGCTTGAGAGTTGGTTCACCCAGTTTGGC
GGACGTCCCATTGCCTTTTGGACGCTACGCACGCCGGAACAGCACAAGCCCACCGGCACCGGATTCGCCGTCTTC
TCCTCTCACGAAGAGGCGGCCGAGAGCCTCTGCATGAACGGACGTGCCTTGAACGAAAAGGCCATCGAGGTGTCA
CCGTCCTCGAGCCGCGTTCTTGATAGAGCTCAGGACATCCTGACGCCGTTCCCGCCTAGCAAGAACCGACCACGG
CCAGGCGATTGGACCTGCCCCTCGTGCGGCTTCTCCAACTTCCAAAGACGGACTGCCTGCTTCCGATGCTCGTTC
CCGGCCATGGGCCCCGGTCCCGGAGGTGAGATGGGCGGCGGCGGCGGCGGATACGGCTACAACTACGGCCCGCCT
ACCATGATGCCACCGCCTCCCCACGGTGGACATCACGGCCCTATGGGTCATGGCGGTCGTATGGGAGGTGGCGGC
GTCGTGCCCTTCCGCGCCGGCGACTGGAAGTGCGGCAATGAAGTGTGCGGCTACCACAACTTCGCCAAGAACGTC
TGCTGTCTTCGATGCGGCGCCAGTCGTGCCGGAGCGGCCGTCGTCGCCGACTCGGGCTACCCGTCTCCCATGGAC
AACGCGTCGCAGTACAGCATGAGCCAGGGCTCCATGGCTGGCACCCCGGGTCCCGGGCCGTTTGGTTCTGGCAAC
TCGTTTGCTTCTGGCGGCGCCTATAATCAGCACTTTGGCGGTCCGCCGAGCCATTTCTTGCCTTCGGGCCTCGGA
GGCGGTGCGGGGACGTATCCGAGTTCTCTCAACGTCCAGGCTTTCGGATCCGGACCCGGCTCGCACCCGGCCGGA
CCCTTTGACAGCCGGGCGGCAGAGGCCGCTTTCCAGTCGGCTACCAATGGACCTGCATCAGCCGGCCCGGGTCCT
TCGAATAATTTCTACAACAGCAGCAATAACGGTGAAAACGACCCTTTCGCATTCCTCTCGAGCGGTATCAGCGGC
CTCTCCGTCAGCGGTGGTGACTCTCGACAGAACGGCGGAGGCGCCCCCCCGAGCAAGTCGCCTGCCTAA
Gene >Ophcf2|00585
ATGTCTTCCCAGCCTCAGCTCAACATCGACCGCTACGTCGTCATTCATGTGGCCACGACATGCGACGAACACGGC
GTCTACGTCACAAAGGACTCGGCCGAGGTCATTGAACTCGGCTGGATCCTCCTTGATGCCAACTCCCTCGAGGAG
GTGAGAGCTACTTCCCATTCTCCCCCCGCGTCTTACCCGTCTAACTTGCCAGATCACCCACGAGAGTGTCCTCGT
GAAGCCAGTCAACACGCCCATCACTCCGCTCTGCAGTAAGTTTCATCCGGTGCTACCACGCCCCATCTCTACTAA
CCGCCGCCTCTCTCCTCAGCAAGCTTGACGACGCTTACCTGGGAGCACGTCCGAAACGCCGGCACCTTCAGAGAC
GCCATCTCTCGATTCGATACATTCGCTACCGAATATCTGACCACCAAGAATCTCGACTTCGTATTCGTTACCCTT
GATGCCTGGGACCTCCGCGTCCAGCTTCCCCGGGAAGCTCGCGACAAGGCCGTCGTCCTCCCCCCGTATTTGCAG
CATTCGCGCACCTTTGACCTGCGCACCGAATACCAGCGCTGGCAGCAGCATCACCCCGAGTCCCTTCCCTTTGGA
CCTTCGATGCTGTCCAACATCTGTGCCGCTCTCGAGGTTGAGCCGGTGCAATCGAGCGCCCCCATTAAGCATAAC
CTGCCCTTTCACCTGCAGGCCCTGGCTCCCGCGTCCCCGCGTCGCGCCATGGAAGAGGCCATTACCCTGGCCCGC
GTCCTCCGAGGCCTGATTCGGAAGTCTCAGCCTCCTCAGGACCACCCCGACGTCCTCACCAGGCCCATGGACGCC
AGAGCCGACGTCAGAGCCTTTTTGTCAGAGAGGAGCAAGGTGCTCCACATGTCAGGGCTACCGCACGACACCACT
CAGTCGGAGCTTGAGAGTTGGTTCACCCAGTTTGGCGGACGTCCCATTGCCTTTTGGACGCTACGCACGCCGGAA
CAGCACAAGCCCACCGGCACCGGATTCGCCGTCTTCTCCTCTCACGAAGAGGTAAGTCATGGACGTTGCATGACG
GCGGGCGCTCAAACAATTGCTGACGAGTACAAGGCGGCCGAGAGCCTCTGCATGAACGGACGTGCCTTGAACGAA
AAGGCCATCGAGGTGTCACCGTCCTCGAGCCGCGTTCTTGATAGAGCTCAGGACATCCTGACGCCGTTCCCGCCT
AGCAAGAACCGACCACGGCCAGGCGATTGGACCTGCCCCTCGTGCGGCTTCTCCAACTTCCAAAGACGGACTGCC
TGCTTCCGATGCTCGTTCCCGGCCATGGGCCCCGGTCCCGGAGGTGAGATGGGCGGCGGCGGCGGCGGATACGGC
TACAACTACGGCCCGCCTACCATGATGCCACCGCCTCCCCACGGTGGACATCACGGCCCTATGGGTCATGGCGGT
CGTATGGGAGGTGGCGGCGTCGTGCCCTTCCGCGCCGGCGACTGGAAGTGCGGCAATGAAGTGTGCGGCTACCAC
AACTTCGCCAAGAACGTCTGCTGTCTTCGATGCGGCGCCAGTCGTGCCGGAGCGGCCGTCGTCGCCGACTCGGGC
TACCCGTCTCCCATGGACAACGCGTCGCAGTACAGCATGAGCCAGGGCTCCATGGCTGGCACCCCGGGTCCCGGG
CCGTTTGGTTCTGGCAACTCGTTTGCTTCTGGCGGCGCCTATAATCAGCACTTTGGCGGTCCGCCGAGCCATTTC
TTGCCTTCGGGCCTCGGAGGCGGTGCGGGGACGTATCCGAGTTCTCTCAACGTCCAGGCTTTCGGATCCGGACCC
GGCTCGCACCCGGCCGGACCCTTTGACAGCCGGGCGGCAGAGGCCGCTTTCCAGTCGGCTACCAATGGACCTGCA
TCAGCCGGCCCGGGTCCTTCGAATAATTTCTACAACAGCAGCAATAACGGTGAAAACGACCCTTTCGCATTCCTC
TCGAGCGGTATCAGCGGCCTCTCCGTCAGCGGTGGTGACTCTCGACAGAACGGCGGAGGCGCCCCCCCGAGCAAG
TCGCCTGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail