Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00581
Gene name
Locationscaffold_01:2292096..2293685
Strand-
Gene length (bp)1589
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 3.0E-12 122 344
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.8E-09 120 340

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5782 0.2639 0.0292 0.1777 0.4154 0.095 0.4196 0.1768 0.3101 0.0672

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 121.78 68.93 174.62
Alive In ants, during behavior modification 76.36 43.74 108.98
Dead In ants, recently dead 78.17 44.78 111.56

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.010394 yes
Alive Dead 0.907011 no
Dead Fungus 0.016062 yes

Orthologs

Orthofinder run ID4
Orthogroup4678
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2643
Ophiocordyceps australis map64 (Brazil) OphauB2|5539
Ophiocordyceps camponoti-floridani Ophcf2|00581 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|325
Ophiocordyceps kimflemingae Ophio5|7611
Ophiocordyceps subramaniannii Hirsu2|9858

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00581
MEWFGKAQLAFTHAPTPVTIKLRDGSDTDLVKICEKATPPCQLNPLLFNGHLQTLWSASKPHGPKVYYRRKTFEA
DDTSYRGSFAVDFAVEPFEGNDPGLPWRTRHFTPDELSHMGSNDAKPMLVILHGLSGGSHEVYLRHAIAPLLQEG
GWEACVVNSRGCAHSKITSGLLYNARSTWDLRQTVKWLRKTYPNRPLFGLGFSLGASMLTTYCGEEGSDCLLKAA
IACSNPFKLDISCRYLLDSLIGREVYLRSMASSLKVLVEEHKKELQLYSDLDMEAIDKITYLPEFDRTVQCPTWG
YPTEQAYYRDASSSDAVLAIRIPFMALHATDDPIAVRQAIPYEEFQQNPSTVLVTSSLGGHLCWFESGGTRWFPR
PICNFFNRMAFDVDLDYLKPREGSTSHTSTAKTTFEPMRRKLNPVDM*
Coding >Ophcf2|00581
ATGGAGTGGTTTGGTAAGGCTCAGCTAGCTTTTACTCACGCTCCAACGCCCGTGACAATCAAGCTCAGGGACGGG
TCGGATACCGACCTGGTCAAGATTTGCGAAAAGGCAACGCCCCCGTGCCAGCTAAACCCGCTTCTGTTCAACGGT
CACCTTCAGACATTATGGTCGGCCAGCAAACCTCATGGCCCCAAGGTCTATTATCGACGCAAGACTTTCGAGGCT
GATGATACGTCATACCGAGGTTCTTTCGCCGTCGACTTCGCCGTCGAGCCCTTCGAAGGCAATGATCCCGGTCTG
CCGTGGAGAACGCGCCACTTCACCCCAGACGAATTGAGCCACATGGGCTCCAACGATGCCAAGCCCATGCTCGTC
ATTCTCCACGGCCTGTCGGGTGGATCACACGAAGTCTATCTTAGACACGCCATCGCTCCTTTGCTGCAAGAGGGT
GGCTGGGAGGCTTGCGTTGTCAACTCGCGAGGCTGCGCGCACAGTAAAATCACCAGCGGCCTGCTGTATAATGCT
CGGAGCACTTGGGACCTGCGACAGACGGTGAAATGGTTGCGCAAGACCTATCCCAACCGGCCTCTCTTTGGCCTC
GGATTCTCTCTTGGCGCCAGCATGCTCACCACTTACTGCGGTGAAGAAGGCTCCGACTGTTTGCTCAAGGCCGCC
ATTGCCTGCTCGAACCCATTCAAGTTGGACATTTCCTGCAGGTATCTGCTAGACAGCCTCATCGGCAGAGAGGTC
TATCTCCGCTCCATGGCCAGCTCGTTGAAAGTTCTGGTAGAGGAACACAAGAAAGAGCTGCAGCTGTACAGCGAT
CTTGACATGGAGGCCATCGACAAGATCACCTACCTCCCCGAGTTCGATCGAACAGTTCAGTGCCCAACTTGGGGC
TATCCCACAGAGCAGGCCTATTACCGCGACGCCTCGTCGTCAGACGCCGTGCTGGCCATCAGGATTCCTTTCATG
GCACTTCACGCTACCGACGATCCTATTGCTGTGCGCCAGGCGATTCCGTACGAGGAGTTCCAGCAGAATCCGAGT
ACGGTTCTGGTCACGTCCTCGCTAGGAGGTCATCTCTGCTGGTTCGAATCGGGCGGGACCAGGTGGTTCCCTCGG
CCGATATGCAACTTCTTCAACCGCATGGCCTTTGACGTCGACCTGGATTACCTCAAGCCGCGGGAGGGCTCGACT
TCTCATACATCGACGGCCAAGACAACCTTTGAGCCGATGCGCCGGAAATTAAACCCCGTCGACATGTAG
Transcript >Ophcf2|00581
ATGGAGTGGTTTGGTAAGGCTCAGCTAGCTTTTACTCACGCTCCAACGCCCGTGACAATCAAGCTCAGGGACGGG
TCGGATACCGACCTGGTCAAGATTTGCGAAAAGGCAACGCCCCCGTGCCAGCTAAACCCGCTTCTGTTCAACGGT
CACCTTCAGACATTATGGTCGGCCAGCAAACCTCATGGCCCCAAGGTCTATTATCGACGCAAGACTTTCGAGGCT
GATGATACGTCATACCGAGGTTCTTTCGCCGTCGACTTCGCCGTCGAGCCCTTCGAAGGCAATGATCCCGGTCTG
CCGTGGAGAACGCGCCACTTCACCCCAGACGAATTGAGCCACATGGGCTCCAACGATGCCAAGCCCATGCTCGTC
ATTCTCCACGGCCTGTCGGGTGGATCACACGAAGTCTATCTTAGACACGCCATCGCTCCTTTGCTGCAAGAGGGT
GGCTGGGAGGCTTGCGTTGTCAACTCGCGAGGCTGCGCGCACAGTAAAATCACCAGCGGCCTGCTGTATAATGCT
CGGAGCACTTGGGACCTGCGACAGACGGTGAAATGGTTGCGCAAGACCTATCCCAACCGGCCTCTCTTTGGCCTC
GGATTCTCTCTTGGCGCCAGCATGCTCACCACTTACTGCGGTGAAGAAGGCTCCGACTGTTTGCTCAAGGCCGCC
ATTGCCTGCTCGAACCCATTCAAGTTGGACATTTCCTGCAGGTATCTGCTAGACAGCCTCATCGGCAGAGAGGTC
TATCTCCGCTCCATGGCCAGCTCGTTGAAAGTTCTGGTAGAGGAACACAAGAAAGAGCTGCAGCTGTACAGCGAT
CTTGACATGGAGGCCATCGACAAGATCACCTACCTCCCCGAGTTCGATCGAACAGTTCAGTGCCCAACTTGGGGC
TATCCCACAGAGCAGGCCTATTACCGCGACGCCTCGTCGTCAGACGCCGTGCTGGCCATCAGGATTCCTTTCATG
GCACTTCACGCTACCGACGATCCTATTGCTGTGCGCCAGGCGATTCCGTACGAGGAGTTCCAGCAGAATCCGAGT
ACGGTTCTGGTCACGTCCTCGCTAGGAGGTCATCTCTGCTGGTTCGAATCGGGCGGGACCAGGTGGTTCCCTCGG
CCGATATGCAACTTCTTCAACCGCATGGCCTTTGACGTCGACCTGGATTACCTCAAGCCGCGGGAGGGCTCGACT
TCTCATACATCGACGGCCAAGACAACCTTTGAGCCGATGCGCCGGAAATTAAACCCCGTCGACATGTAG
Gene >Ophcf2|00581
ATGGAGTGGTTTGGTAAGGCTCAGCTAGCTTTTACTCACGCTCCAACGCCCGTGACAATCAAGCTCAGGGACGGG
TCGGATACCGACCTGGTCAAGATTTGCGAAAAGGCAACGCCCCCGTGCCAGCTAAACCCGCTTCTGTTCAACGGT
CACCTTCAGACATTATGGTCGGCCAGCAAACCTCATGGCCCCAAGGTCTATTATCGACGCAAGACTTTCGAGGCT
GATGATACGTCATACCGAGGTTCTTTCGCCGTCGACTTCGCCGTCGAGCCCTTCGAAGGCAATGATCCCGGTCTG
CCGTGGAGAACGCGCCACTTCACCCCAGACGAATTGAGCCACATGGGCTCCAACGATGCCAAGCCCATGCTCGTC
ATTCTCCACGGCCTGTCGGGTGGATCACACGAAGTCTATCTTAGACACGCCATCGCTCCTTTGCTGCAAGAGGGT
GGCTGGGAGGCTTGCGTTGTCAACTCGCGAGGCTGCGCGCACAGTAAAATCACCAGCGGCCTGCTGTATAATGCT
CGGAGCACTTGGGACCTGCGACAGGTTTGTGGACGTCTGATTACTGCGTCTCGGCCACGCTGATGGCATCAGACG
GTGAAATGGTTGCGCAAGACCTATCCCAACCGGCCTCTCTTTGGCCTCGGATTCTCTCTTGGCGCCAGCATGCTC
ACCACTGTAAGTATATCATGGTCTGTTATCCTGTGAGCCGGCCTAGACAGTAACGTGTGGCAACAGTACTGCGGT
GAAGAAGGCTCCGACTGTTTGCTCAAGGCCGCCATTGCCTGCTCGAACCCATTCAAGTTGGACATTTCCTGCAGG
TATCTGCTAGACAGCCTCATCGGCAGAGAGGTCTATCTCCGCTCCATGGCCAGTGAGTCTGTACCAGCCGGCCGC
ACGTCTTCGGAGCTGACCACGAGCTCAGGCTCGTTGAAAGTTCTGGTAGAGGAACACAAGAAAGAGCTGCAGCTG
TACAGCGATCTTGACATGGAGGCCATCGACAAGATCACCTACCTCCCCGAGTTCGATCGAACAGTTCAGTGCGTT
ATGCCGCAACGCCCATGTACCTACCACTTTCTTTTCTCACCGACTTCGCAGGTGCCCAACTTGGGGCTATCCCAC
AGAGCAGGCCTATTACCGCGACGCCTCGTCGTCAGACGCCGTGCTGGCCATCAGGATTCCTTTCATGGCACTTCA
CGCTACCGACGATCCTGTAAGAAAGCTGGGTCTGACGCCATATAGAATGCATGGCCTAACGTATAAGCAGATTGC
TGTGCGCCAGGCGATTCCGTACGAGGAGTTCCAGCAGAATCCGAGTACGGTTCTGGTCACGTCCTCGCTAGGAGG
TCATCTCTGCTGGTTCGAATCGGGCGGGACCAGGTGGTTCCCTCGGCCGGTACGATGATCCGACATTGACTGCCT
TCAGCCGGCTGACTCTGGTCCAGATATGCAACTTCTTCAACCGCATGGCCTTTGACGTCGACCTGGATTACCTCA
AGCCGCGGGAGGGCTCGACTTCTCATACATCGACGGCCAAGACAACCTTTGAGCCGATGCGCCGGAAATTAAACC
CCGTCGACATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail