Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00578
Gene name
Locationscaffold_01:2283476..2284605
Strand+
Gene length (bp)1129
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 8.0E-30 70 172
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.4E-24 182 289

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 40 58 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00578
MTAIDSRPPWLSRHYIDYVYAPAALLILGTFIVKASWAPYAALLALILGGYNFWNFQIKKVLKPDVFQEFELLEK
TVISHNVAIYRFKLPTSQSVLGLPIGQHISIGAPLIQPDGSTKEIVRSYTPISGDHQPGHFDLLIKSYPQGNISK
LMASLVVGQTIRVRGPKGAFVYTPNMVRHFGMIAGGTGITPMLQIIRAIVRGRPIGDKTQVDLIFANVALQDILL
KEDLDTLVQADAGIRVHFVLDNPPEGWTGGVGYVTPDMISKWLPKPAADVKILLCGPPPMVSGLKKATDSLGFAK
AQPVSKLADQVFAF*
Coding >Ophcf2|00578
ATGACCGCCATCGATAGCCGGCCTCCGTGGCTTTCGCGTCACTACATCGACTACGTCTACGCCCCCGCCGCCCTC
CTCATATTGGGAACCTTCATCGTCAAGGCCAGTTGGGCCCCCTATGCCGCACTGCTTGCCCTGATCCTGGGCGGT
TACAACTTCTGGAACTTCCAGATCAAGAAGGTTCTCAAACCAGATGTCTTCCAAGAGTTTGAGCTCCTGGAGAAG
ACGGTCATCTCGCACAACGTCGCCATTTACCGGTTCAAGCTCCCGACATCGCAGTCTGTCCTCGGCCTGCCTATC
GGCCAGCACATCTCCATCGGCGCGCCTCTCATTCAACCCGATGGCAGCACCAAGGAGATCGTCCGCTCCTACACG
CCCATCTCGGGCGACCACCAGCCCGGCCACTTCGATCTCCTCATCAAGTCGTATCCCCAAGGCAACATCTCCAAG
CTAATGGCCTCTCTCGTCGTCGGCCAGACGATTCGTGTTCGAGGCCCCAAGGGCGCATTCGTCTATACACCCAAC
ATGGTCCGCCACTTCGGCATGATTGCCGGCGGCACGGGCATCACCCCCATGCTTCAGATCATCCGGGCCATCGTT
CGCGGCCGTCCCATCGGTGACAAGACCCAAGTCGATCTCATCTTCGCCAACGTCGCCCTTCAAGACATCCTGCTC
AAGGAGGACCTGGATACCCTGGTGCAGGCCGATGCAGGCATACGCGTTCATTTCGTCCTCGACAACCCTCCCGAG
GGCTGGACCGGCGGCGTCGGCTACGTCACGCCCGACATGATCTCAAAATGGCTTCCCAAGCCCGCCGCCGACGTC
AAGATCCTCCTCTGCGGCCCACCCCCAATGGTAAGCGGCCTAAAGAAGGCAACGGACAGTCTGGGCTTCGCCAAG
GCCCAGCCCGTCAGCAAGCTCGCCGATCAGGTCTTTGCCTTCTAA
Transcript >Ophcf2|00578
ATGACCGCCATCGATAGCCGGCCTCCGTGGCTTTCGCGTCACTACATCGACTACGTCTACGCCCCCGCCGCCCTC
CTCATATTGGGAACCTTCATCGTCAAGGCCAGTTGGGCCCCCTATGCCGCACTGCTTGCCCTGATCCTGGGCGGT
TACAACTTCTGGAACTTCCAGATCAAGAAGGTTCTCAAACCAGATGTCTTCCAAGAGTTTGAGCTCCTGGAGAAG
ACGGTCATCTCGCACAACGTCGCCATTTACCGGTTCAAGCTCCCGACATCGCAGTCTGTCCTCGGCCTGCCTATC
GGCCAGCACATCTCCATCGGCGCGCCTCTCATTCAACCCGATGGCAGCACCAAGGAGATCGTCCGCTCCTACACG
CCCATCTCGGGCGACCACCAGCCCGGCCACTTCGATCTCCTCATCAAGTCGTATCCCCAAGGCAACATCTCCAAG
CTAATGGCCTCTCTCGTCGTCGGCCAGACGATTCGTGTTCGAGGCCCCAAGGGCGCATTCGTCTATACACCCAAC
ATGGTCCGCCACTTCGGCATGATTGCCGGCGGCACGGGCATCACCCCCATGCTTCAGATCATCCGGGCCATCGTT
CGCGGCCGTCCCATCGGTGACAAGACCCAAGTCGATCTCATCTTCGCCAACGTCGCCCTTCAAGACATCCTGCTC
AAGGAGGACCTGGATACCCTGGTGCAGGCCGATGCAGGCATACGCGTTCATTTCGTCCTCGACAACCCTCCCGAG
GGCTGGACCGGCGGCGTCGGCTACGTCACGCCCGACATGATCTCAAAATGGCTTCCCAAGCCCGCCGCCGACGTC
AAGATCCTCCTCTGCGGCCCACCCCCAATGGTAAGCGGCCTAAAGAAGGCAACGGACAGTCTGGGCTTCGCCAAG
GCCCAGCCCGTCAGCAAGCTCGCCGATCAGGTCTTTGCCTTCTAA
Gene >Ophcf2|00578
ATGACCGCCATCGATAGCCGGCCTCCGTGGCTTTCGCGTCACTACATCGACTACGTCTACGCCCCCGCCGCCCTC
CTCATATTGGGAACCTTCATCGTCAAGGCCAGTTGGGCCCCCTATGCCGCACTGCTTGCCCTGATCCTGGGCGGT
TACAACTTCTGGAACTTCCGTGAGTGTGCCGCTGATCCGGGCGCGAGGCTGGTCAACTCACGCGTTATGCCCTAC
AGAGATCAAGAAGGTTCTCAAACCAGATGTCTTCCAAGAGTTTGAGCTCCTGGAGAAGACGGTCATCTCGCACAA
CGTCGCCATGTCAGTAGCCATCCTCGTATTCGCCTTCTTTACCTTACCCGTCCCATCTGATTTCGGCTCGCTCCA
GTTACCGGTTCAAGCTCCCGACATCGCAGTCTGTCCTCGGCCTGCCTATCGGCCAGCACATCTCCATCGGCGCGC
CTCTCATTCAACCCGATGGCAGCACCAAGGAGATCGTCCGCTCCTACACGCCCATCTCGGGCGACCACCAGCCCG
GCCACTTCGATCTCCTCATCAAGTCGTATCCCCAAGGCAACATCTCCAAGCTAATGGCCTCTCTCGTCGTCGGCC
AGACGATTCGTGTTCGAGGCCCCAAGGGCGCATTCGTCTATACACCCAACATGGTCCGCCACTTCGGCATGATTG
CCGGCGGCACGGGCATCACCCCCATGCTTCAGATCATCCGGGCCATCGTTCGCGGCCGTCCCATCGGTGACAAGA
CCCAAGTCGATCTCATCTTCGCCAACGTCGCCCTTCAAGACATCCTGCTCAAGGAGGACCTGGATACCCTGGTGC
AGGCCGATGCAGGCATACGCGTTCATTTCGTCCTCGACAACCCTCCCGAGGGCTGGACCGGCGGCGTCGGCTACG
TCACGCCCGACATGATCTCAGTAGGCTCCAGCCCCCTTTCCCCCCTACCCCTCCCTCACTCCGCAACTAACACCA
GTAGAAATGGCTTCCCAAGCCCGCCGCCGACGTCAAGATCCTCCTCTGCGGCCCACCCCCAATGGTAAGCGGCCT
AAAGAAGGCAACGGACAGTCTGGGCTTCGCCAAGGCCCAGCCCGTCAGCAAGCTCGCCGATCAGGTCTTTGCCTT
CTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail