Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00565
Gene name
Locationscaffold_01:2248296..2251418
Strand+
Gene length (bp)3122
Transcript length (bp)3063
Coding sequence length (bp)3063
Protein length (aa) 1021

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain 3.0E-63 20 250
PF13299 CPSF100_C Cleavage and polyadenylation factor 2 C-terminal 1.5E-50 811 1014
PF10996 Beta-Casp Beta-Casp domain 1.3E-16 296 434
PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain 9.2E-15 730 794

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2531 0.9137 0.1374 0.0079 0.1391 0.0176 0.0313 0.0043 0.0259 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2553
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5972
Ophiocordyceps australis map64 (Brazil) OphauB2|2844
Ophiocordyceps camponoti-floridani Ophcf2|00565 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7575
Ophiocordyceps kimflemingae Ophio5|1215
Ophiocordyceps subramaniannii Hirsu2|3782

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00565
MFSFCPLQGALSESTASQYLLELDGGVKVLVDLGWDESFDVDKLEELEKHVPTLSLILLTHATVSHLAAYVHCCK
NIPLFTRVPAYATRPVIDLGRSLTQDLYSSTPAASTTISQSSLSDLAYSFSQTAPAAQNLLLESPTPDEIARYFS
LIQPLKYSQPHQPLPSPFSPPLNGLTITAYNAGHTLGGTIWHIQHGLESIVYAVDWNQARENVFAGAAWLDGGGG
SGGGGGGGGGGAEVIEQLRKPTALVCSSRGAQRTAQVGGRVKRDETLIDMIKACVSNRGTVLIPVDSSARVLEMA
YLLEHAWRSDAASPDGTLKSAKLYLAGRNMSSTMRYARSMLEWMDNNIVQEFEACAEGQRRANGPAGDSKDGGPF
DFRHLRLVERKAQVAKLLSSEGQGRVILASDTSMEWGFSRDLIRGLAGDPDNLVILTDKPGMAGDGNPSIARRLW
EWWRERRDGVQVTQTASGDSVETVYCGGREIEIREATRRALEGDELAVYQQWLATQRQLQATQQAGGAAALEASA
DVDDASSESSSDSDDDEGQQQGKALTVSATMGQAGRKNMVLKDEDVGINVLLKKKGVYDFDSRGKRGRDRCFPMP
IRRKRNDDFGELVRPEDYLRAEEKDEDNGGEGGDEAAEDDKPGKKRKWDDVAKQASGRPRKRVQMGGPRAPLAAA
AAAAAAAAAAATASDEADGGDVAEHDDLDAVDEPEAEEPKGPCKAVYSSELVTAKLRIGFVDFSGLHDRRSLDML
IPLIQPRKLILVGGNREETTALAADCRAALGLEGSDKAVDVFTPEVGVWVDASVDTNAWIVRLADSLVKKLKWQR
VRGLSIVTISGQLLAVEAGDGNGDGDGDVIKMNRTREEGEDKDDEDGDDKADDDDNDDNDDNDNDNDNNGAPSAK
RLKTEPGTAMAITAWAPSTALPVLDAVPPSRLSATRTAAQPLHVGDLRLADLRRAMQGDGHGAEFRGEGMLVVDG
TVAVRKTTEGRVEVESVGLPATGKRSTVYAVKKAIYDGLAVVAGA*
Coding >Ophcf2|00565
ATGTTCTCATTCTGCCCGCTTCAGGGCGCCCTCTCGGAGTCAACCGCCTCGCAGTACCTCCTCGAGCTCGACGGC
GGAGTCAAGGTCCTCGTCGACCTGGGCTGGGACGAATCCTTCGACGTCGACAAGCTTGAAGAGCTGGAAAAACAC
GTGCCCACGCTCTCGCTCATCCTCCTCACACACGCCACCGTCTCCCACCTCGCCGCCTACGTCCACTGCTGCAAG
AATATACCTCTCTTCACCCGCGTCCCGGCCTACGCAACCCGTCCCGTCATCGATCTGGGCCGCTCACTTACTCAG
GATCTCTACTCTTCTACGCCCGCCGCCTCGACGACAATCTCACAGAGCTCGCTCTCCGACCTGGCCTACTCCTTC
TCCCAGACGGCTCCGGCGGCGCAGAACCTACTCCTCGAGTCGCCGACGCCGGACGAGATTGCCCGGTACTTTTCT
CTCATCCAGCCTCTCAAATACTCGCAGCCTCATCAGCCGCTGCCCTCGCCCTTCTCCCCGCCCCTCAACGGCTTG
ACCATCACGGCTTATAATGCCGGCCACACACTGGGCGGCACCATCTGGCATATACAGCACGGTCTCGAGTCCATC
GTCTACGCCGTCGACTGGAACCAAGCTCGTGAAAACGTCTTCGCCGGTGCCGCCTGGCTTGATGGCGGCGGCGGC
AGCGGCGGCGGCGGTGGAGGCGGTGGTGGCGGAGCCGAGGTCATCGAGCAGTTGCGCAAGCCGACGGCGCTCGTA
TGCAGCAGTCGAGGCGCTCAGAGGACGGCGCAGGTGGGCGGACGCGTCAAGAGGGACGAGACGCTCATCGACATG
ATCAAGGCCTGTGTCTCCAACCGAGGAACGGTGCTGATCCCCGTCGACTCTAGCGCTCGCGTCCTCGAGATGGCC
TACCTCCTCGAGCACGCCTGGAGGTCCGACGCCGCCTCGCCGGACGGCACGCTCAAGTCGGCCAAGCTCTACCTT
GCCGGCCGCAACATGTCGAGCACCATGCGTTACGCCAGAAGCATGCTGGAGTGGATGGACAACAACATCGTCCAG
GAGTTCGAGGCCTGCGCCGAGGGGCAGCGCAGGGCCAACGGACCTGCCGGCGACAGCAAGGACGGCGGGCCCTTT
GACTTTAGGCATCTGCGCCTGGTCGAGCGAAAGGCGCAGGTGGCCAAGTTGCTGAGCAGCGAGGGCCAGGGTCGC
GTCATCCTCGCCAGCGACACCAGCATGGAATGGGGCTTCTCCAGGGATCTGATCAGGGGCCTCGCCGGCGACCCG
GACAACCTCGTCATCCTCACCGACAAGCCCGGAATGGCCGGCGACGGCAACCCCTCGATCGCGAGGAGGCTGTGG
GAGTGGTGGAGGGAGAGGCGAGACGGCGTCCAGGTGACGCAGACGGCGAGCGGCGACAGTGTAGAGACGGTCTAC
TGCGGCGGGCGCGAAATCGAGATCCGGGAGGCGACTCGTCGGGCGCTCGAGGGCGACGAGCTGGCCGTCTATCAG
CAATGGCTCGCCACTCAGAGGCAGCTGCAGGCGACGCAGCAGGCGGGCGGAGCGGCGGCCCTGGAGGCGTCGGCC
GACGTGGACGATGCTTCGTCCGAATCCTCGTCGGACTCGGACGACGACGAGGGCCAGCAGCAGGGCAAAGCGCTG
ACCGTGTCGGCTACCATGGGTCAGGCGGGACGCAAGAACATGGTGCTCAAGGACGAAGATGTCGGCATCAACGTG
CTGCTCAAGAAGAAGGGCGTCTACGACTTTGACTCGCGCGGGAAGAGAGGCCGTGACCGGTGCTTCCCGATGCCG
ATCCGGCGGAAGCGCAACGACGACTTCGGCGAGCTCGTACGGCCGGAAGACTACCTCCGAGCCGAGGAGAAGGAT
GAGGACAACGGCGGCGAAGGCGGCGACGAGGCTGCCGAGGACGACAAGCCGGGAAAGAAGCGCAAATGGGACGAC
GTCGCCAAGCAGGCCTCGGGCCGGCCGAGGAAGCGCGTACAGATGGGCGGACCGAGAGCTCCGTTGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAACGGCTTCGGACGAGGCCGACGGGGGCGACGTCGCCGAACAC
GATGATCTGGACGCCGTGGACGAGCCGGAGGCGGAAGAGCCCAAGGGTCCTTGCAAGGCCGTTTACAGCTCCGAG
CTGGTGACGGCCAAGCTGCGCATCGGCTTCGTCGACTTTAGCGGGCTCCACGACCGGCGAAGCCTCGACATGCTC
ATCCCGCTGATCCAGCCTCGCAAGCTGATACTCGTGGGAGGCAACCGGGAAGAGACGACGGCGCTGGCGGCAGAC
TGTCGGGCAGCGCTGGGGCTGGAAGGGAGCGACAAGGCCGTCGACGTCTTCACACCCGAGGTGGGAGTCTGGGTA
GACGCCAGCGTGGACACGAACGCCTGGATCGTCCGGCTGGCGGACTCGCTGGTCAAGAAGCTCAAGTGGCAAAGG
GTACGGGGGCTGAGCATCGTCACCATCAGCGGCCAGCTGCTGGCGGTCGAGGCCGGCGACGGCAACGGCGACGGC
GACGGCGACGTCATCAAGATGAACAGGACGAGAGAAGAAGGCGAGGACAAGGATGACGAAGACGGCGACGATAAA
GCCGACGACGACGACAACGACGACAACGACGACAACGACAACGACAACGACAACAACGGGGCACCATCAGCAAAG
CGGCTCAAGACGGAACCGGGCACAGCAATGGCAATCACGGCGTGGGCCCCGTCCACGGCTCTGCCCGTCCTCGAC
GCCGTGCCCCCGAGCCGGCTATCGGCAACGCGGACGGCAGCCCAGCCGCTACACGTGGGCGATCTACGGCTAGCC
GACCTCCGACGGGCCATGCAGGGGGACGGACACGGAGCCGAGTTCCGGGGCGAGGGCATGCTCGTCGTCGACGGC
ACCGTCGCCGTCCGCAAGACCACCGAGGGCCGGGTCGAGGTCGAGAGCGTAGGCCTGCCGGCGACGGGGAAGAGG
AGTACGGTCTATGCCGTCAAGAAGGCCATTTACGACGGCCTGGCTGTGGTTGCGGGCGCGTGA
Transcript >Ophcf2|00565
ATGTTCTCATTCTGCCCGCTTCAGGGCGCCCTCTCGGAGTCAACCGCCTCGCAGTACCTCCTCGAGCTCGACGGC
GGAGTCAAGGTCCTCGTCGACCTGGGCTGGGACGAATCCTTCGACGTCGACAAGCTTGAAGAGCTGGAAAAACAC
GTGCCCACGCTCTCGCTCATCCTCCTCACACACGCCACCGTCTCCCACCTCGCCGCCTACGTCCACTGCTGCAAG
AATATACCTCTCTTCACCCGCGTCCCGGCCTACGCAACCCGTCCCGTCATCGATCTGGGCCGCTCACTTACTCAG
GATCTCTACTCTTCTACGCCCGCCGCCTCGACGACAATCTCACAGAGCTCGCTCTCCGACCTGGCCTACTCCTTC
TCCCAGACGGCTCCGGCGGCGCAGAACCTACTCCTCGAGTCGCCGACGCCGGACGAGATTGCCCGGTACTTTTCT
CTCATCCAGCCTCTCAAATACTCGCAGCCTCATCAGCCGCTGCCCTCGCCCTTCTCCCCGCCCCTCAACGGCTTG
ACCATCACGGCTTATAATGCCGGCCACACACTGGGCGGCACCATCTGGCATATACAGCACGGTCTCGAGTCCATC
GTCTACGCCGTCGACTGGAACCAAGCTCGTGAAAACGTCTTCGCCGGTGCCGCCTGGCTTGATGGCGGCGGCGGC
AGCGGCGGCGGCGGTGGAGGCGGTGGTGGCGGAGCCGAGGTCATCGAGCAGTTGCGCAAGCCGACGGCGCTCGTA
TGCAGCAGTCGAGGCGCTCAGAGGACGGCGCAGGTGGGCGGACGCGTCAAGAGGGACGAGACGCTCATCGACATG
ATCAAGGCCTGTGTCTCCAACCGAGGAACGGTGCTGATCCCCGTCGACTCTAGCGCTCGCGTCCTCGAGATGGCC
TACCTCCTCGAGCACGCCTGGAGGTCCGACGCCGCCTCGCCGGACGGCACGCTCAAGTCGGCCAAGCTCTACCTT
GCCGGCCGCAACATGTCGAGCACCATGCGTTACGCCAGAAGCATGCTGGAGTGGATGGACAACAACATCGTCCAG
GAGTTCGAGGCCTGCGCCGAGGGGCAGCGCAGGGCCAACGGACCTGCCGGCGACAGCAAGGACGGCGGGCCCTTT
GACTTTAGGCATCTGCGCCTGGTCGAGCGAAAGGCGCAGGTGGCCAAGTTGCTGAGCAGCGAGGGCCAGGGTCGC
GTCATCCTCGCCAGCGACACCAGCATGGAATGGGGCTTCTCCAGGGATCTGATCAGGGGCCTCGCCGGCGACCCG
GACAACCTCGTCATCCTCACCGACAAGCCCGGAATGGCCGGCGACGGCAACCCCTCGATCGCGAGGAGGCTGTGG
GAGTGGTGGAGGGAGAGGCGAGACGGCGTCCAGGTGACGCAGACGGCGAGCGGCGACAGTGTAGAGACGGTCTAC
TGCGGCGGGCGCGAAATCGAGATCCGGGAGGCGACTCGTCGGGCGCTCGAGGGCGACGAGCTGGCCGTCTATCAG
CAATGGCTCGCCACTCAGAGGCAGCTGCAGGCGACGCAGCAGGCGGGCGGAGCGGCGGCCCTGGAGGCGTCGGCC
GACGTGGACGATGCTTCGTCCGAATCCTCGTCGGACTCGGACGACGACGAGGGCCAGCAGCAGGGCAAAGCGCTG
ACCGTGTCGGCTACCATGGGTCAGGCGGGACGCAAGAACATGGTGCTCAAGGACGAAGATGTCGGCATCAACGTG
CTGCTCAAGAAGAAGGGCGTCTACGACTTTGACTCGCGCGGGAAGAGAGGCCGTGACCGGTGCTTCCCGATGCCG
ATCCGGCGGAAGCGCAACGACGACTTCGGCGAGCTCGTACGGCCGGAAGACTACCTCCGAGCCGAGGAGAAGGAT
GAGGACAACGGCGGCGAAGGCGGCGACGAGGCTGCCGAGGACGACAAGCCGGGAAAGAAGCGCAAATGGGACGAC
GTCGCCAAGCAGGCCTCGGGCCGGCCGAGGAAGCGCGTACAGATGGGCGGACCGAGAGCTCCGTTGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAACGGCTTCGGACGAGGCCGACGGGGGCGACGTCGCCGAACAC
GATGATCTGGACGCCGTGGACGAGCCGGAGGCGGAAGAGCCCAAGGGTCCTTGCAAGGCCGTTTACAGCTCCGAG
CTGGTGACGGCCAAGCTGCGCATCGGCTTCGTCGACTTTAGCGGGCTCCACGACCGGCGAAGCCTCGACATGCTC
ATCCCGCTGATCCAGCCTCGCAAGCTGATACTCGTGGGAGGCAACCGGGAAGAGACGACGGCGCTGGCGGCAGAC
TGTCGGGCAGCGCTGGGGCTGGAAGGGAGCGACAAGGCCGTCGACGTCTTCACACCCGAGGTGGGAGTCTGGGTA
GACGCCAGCGTGGACACGAACGCCTGGATCGTCCGGCTGGCGGACTCGCTGGTCAAGAAGCTCAAGTGGCAAAGG
GTACGGGGGCTGAGCATCGTCACCATCAGCGGCCAGCTGCTGGCGGTCGAGGCCGGCGACGGCAACGGCGACGGC
GACGGCGACGTCATCAAGATGAACAGGACGAGAGAAGAAGGCGAGGACAAGGATGACGAAGACGGCGACGATAAA
GCCGACGACGACGACAACGACGACAACGACGACAACGACAACGACAACGACAACAACGGGGCACCATCAGCAAAG
CGGCTCAAGACGGAACCGGGCACAGCAATGGCAATCACGGCGTGGGCCCCGTCCACGGCTCTGCCCGTCCTCGAC
GCCGTGCCCCCGAGCCGGCTATCGGCAACGCGGACGGCAGCCCAGCCGCTACACGTGGGCGATCTACGGCTAGCC
GACCTCCGACGGGCCATGCAGGGGGACGGACACGGAGCCGAGTTCCGGGGCGAGGGCATGCTCGTCGTCGACGGC
ACCGTCGCCGTCCGCAAGACCACCGAGGGCCGGGTCGAGGTCGAGAGCGTAGGCCTGCCGGCGACGGGGAAGAGG
AGTACGGTCTATGCCGTCAAGAAGGCCATTTACGACGGCCTGGCTGTGGTTGCGGGCGCGTGA
Gene >Ophcf2|00565
ATGTTCTCATTCTGCCCGCTTCAGGGCGCCCTCTCGGAGTCAACCGCCTCGCAGTACCTCCTCGAGCTCGACGGC
GGAGTCAAGGTCCTCGTCGACCTGGGCTGGGACGAATCCTTCGACGTCGACAAGCTTGAAGAGCTGGAAAAGTTG
AGAGGTTCCCCCGATTTACCCTCGTCTGTACGCTCCTAAATGACTGAGAAATCAGACACGTGCCCACGCTCTCGC
TCATCCTCCTCACACACGCCACCGTCTCCCACCTCGCCGCCTACGTCCACTGCTGCAAGAATATACCTCTCTTCA
CCCGCGTCCCGGCCTACGCAACCCGTCCCGTCATCGATCTGGGCCGCTCACTTACTCAGGATCTCTACTCTTCTA
CGCCCGCCGCCTCGACGACAATCTCACAGAGCTCGCTCTCCGACCTGGCCTACTCCTTCTCCCAGACGGCTCCGG
CGGCGCAGAACCTACTCCTCGAGTCGCCGACGCCGGACGAGATTGCCCGGTACTTTTCTCTCATCCAGCCTCTCA
AATACTCGCAGCCTCATCAGCCGCTGCCCTCGCCCTTCTCCCCGCCCCTCAACGGCTTGACCATCACGGCTTATA
ATGCCGGCCACACACTGGGCGGCACCATCTGGCATATACAGCACGGTCTCGAGTCCATCGTCTACGCCGTCGACT
GGAACCAAGCTCGTGAAAACGTCTTCGCCGGTGCCGCCTGGCTTGATGGCGGCGGCGGCAGCGGCGGCGGCGGTG
GAGGCGGTGGTGGCGGAGCCGAGGTCATCGAGCAGTTGCGCAAGCCGACGGCGCTCGTATGCAGCAGTCGAGGCG
CTCAGAGGACGGCGCAGGTGGGCGGACGCGTCAAGAGGGACGAGACGCTCATCGACATGATCAAGGCCTGTGTCT
CCAACCGAGGAACGGTGCTGATCCCCGTCGACTCTAGCGCTCGCGTCCTCGAGATGGCCTACCTCCTCGAGCACG
CCTGGAGGTCCGACGCCGCCTCGCCGGACGGCACGCTCAAGTCGGCCAAGCTCTACCTTGCCGGCCGCAACATGT
CGAGCACCATGCGTTACGCCAGAAGCATGCTGGAGTGGATGGACAACAACATCGTCCAGGAGTTCGAGGCCTGCG
CCGAGGGGCAGCGCAGGGCCAACGGACCTGCCGGCGACAGCAAGGACGGCGGGCCCTTTGACTTTAGGCATCTGC
GCCTGGTCGAGCGAAAGGCGCAGGTGGCCAAGTTGCTGAGCAGCGAGGGCCAGGGTCGCGTCATCCTCGCCAGCG
ACACCAGCATGGAATGGGGCTTCTCCAGGGATCTGATCAGGGGCCTCGCCGGCGACCCGGACAACCTCGTCATCC
TCACCGACAAGCCCGGAATGGCCGGCGACGGCAACCCCTCGATCGCGAGGAGGCTGTGGGAGTGGTGGAGGGAGA
GGCGAGACGGCGTCCAGGTGACGCAGACGGCGAGCGGCGACAGTGTAGAGACGGTCTACTGCGGCGGGCGCGAAA
TCGAGATCCGGGAGGCGACTCGTCGGGCGCTCGAGGGCGACGAGCTGGCCGTCTATCAGCAATGGCTCGCCACTC
AGAGGCAGCTGCAGGCGACGCAGCAGGCGGGCGGAGCGGCGGCCCTGGAGGCGTCGGCCGACGTGGACGATGCTT
CGTCCGAATCCTCGTCGGACTCGGACGACGACGAGGGCCAGCAGCAGGGCAAAGCGCTGACCGTGTCGGCTACCA
TGGGTCAGGCGGGACGCAAGAACATGGTGCTCAAGGACGAAGATGTCGGCATCAACGTGCTGCTCAAGAAGAAGG
GCGTCTACGACTTTGACTCGCGCGGGAAGAGAGGCCGTGACCGGTGCTTCCCGATGCCGATCCGGCGGAAGCGCA
ACGACGACTTCGGCGAGCTCGTACGGCCGGAAGACTACCTCCGAGCCGAGGAGAAGGATGAGGACAACGGCGGCG
AAGGCGGCGACGAGGCTGCCGAGGACGACAAGCCGGGAAAGAAGCGCAAATGGGACGACGTCGCCAAGCAGGCCT
CGGGCCGGCCGAGGAAGCGCGTACAGATGGGCGGACCGAGAGCTCCGTTGGCGGCGGCGGCGGCGGCGGCGGCGG
CGGCGGCGGCGGCGGCAACGGCTTCGGACGAGGCCGACGGGGGCGACGTCGCCGAACACGATGATCTGGACGCCG
TGGACGAGCCGGAGGCGGAAGAGCCCAAGGGTCCTTGCAAGGCCGTTTACAGCTCCGAGCTGGTGACGGCCAAGC
TGCGCATCGGCTTCGTCGACTTTAGCGGGCTCCACGACCGGCGAAGCCTCGACATGCTCATCCCGCTGATCCAGC
CTCGCAAGCTGATACTCGTGGGAGGCAACCGGGAAGAGACGACGGCGCTGGCGGCAGACTGTCGGGCAGCGCTGG
GGCTGGAAGGGAGCGACAAGGCCGTCGACGTCTTCACACCCGAGGTGGGAGTCTGGGTAGACGCCAGCGTGGACA
CGAACGCCTGGATCGTCCGGCTGGCGGACTCGCTGGTCAAGAAGCTCAAGTGGCAAAGGGTACGGGGGCTGAGCA
TCGTCACCATCAGCGGCCAGCTGCTGGCGGTCGAGGCCGGCGACGGCAACGGCGACGGCGACGGCGACGTCATCA
AGATGAACAGGACGAGAGAAGAAGGCGAGGACAAGGATGACGAAGACGGCGACGATAAAGCCGACGACGACGACA
ACGACGACAACGACGACAACGACAACGACAACGACAACAACGGGGCACCATCAGCAAAGCGGCTCAAGACGGAAC
CGGGCACAGCAATGGCAATCACGGCGTGGGCCCCGTCCACGGCTCTGCCCGTCCTCGACGCCGTGCCCCCGAGCC
GGCTATCGGCAACGCGGACGGCAGCCCAGCCGCTACACGTGGGCGATCTACGGCTAGCCGACCTCCGACGGGCCA
TGCAGGGGGACGGACACGGAGCCGAGTTCCGGGGCGAGGGCATGCTCGTCGTCGACGGCACCGTCGCCGTCCGCA
AGACCACCGAGGGCCGGGTCGAGGTCGAGAGCGTAGGCCTGCCGGCGACGGGGAAGAGGAGTACGGTCTATGCCG
TCAAGAAGGCCATTTACGACGGCCTGGCTGTGGTTGCGGGCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail