Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00564
Gene name
Locationscaffold_01:2246269..2247674
Strand-
Gene length (bp)1405
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 4.0E-08 150 394
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.5E-06 8 40

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00564
MDDHRVIICGAGISGLVLAHALAKAGIAFDVYERDEHINARLHGWGITFHWALPYLREMLDEETLAAIDDVQVDP
EVGRHDTGNFLFLNLASLDVKFKVPPNERRRVNRQRLREALVRGVADRVHWGKRLVDIEPLTGSTLVRAVFADGT
DVRGRLLVGADGTGSLTRRFLVPDGHSNHRLPVRMLGVSIDVSPAEAQPLRDLDPLLFMGCHPETGHFLWVSILD
TPDTNGSRGTAGEYYRIQVIISWLAHVDGNDSPATTTTTTTTTTTTTTTTSTTTSTKTTSDGSRLAEMKRRSTGF
HPRLRSLIESIPPSTVVTEIALQDWPCHQAWNNHAGRVTLVGDAAHAMTMYRGEAANHGILDVWHLSRAMSSQHH
QPQAQAVAAYEAEMRARAVPAVLLSRQACLDAHDYHALDENSALLKRRALQAAE*
Coding >Ophcf2|00564
ATGGACGACCACCGCGTCATCATCTGCGGCGCAGGCATCAGCGGCCTCGTGCTCGCCCACGCATTGGCCAAGGCC
GGCATCGCCTTCGACGTCTACGAGCGCGATGAGCACATCAACGCCCGTCTCCATGGCTGGGGCATCACCTTCCAC
TGGGCTCTCCCGTACCTGAGGGAGATGCTAGATGAGGAGACACTTGCAGCCATAGACGACGTCCAGGTTGATCCC
GAGGTCGGCCGCCACGACACGGGCAACTTCCTGTTCCTCAACCTGGCAAGCCTCGACGTCAAGTTCAAGGTACCG
CCCAACGAGCGCCGACGGGTCAACCGCCAGCGGCTTCGAGAGGCACTCGTCCGGGGCGTCGCCGACCGCGTCCAT
TGGGGCAAACGTCTGGTGGACATCGAGCCCCTGACCGGCTCGACCCTCGTCCGCGCCGTCTTCGCCGACGGGACC
GACGTCCGCGGCCGGCTGCTGGTTGGCGCCGACGGTACCGGCTCACTTACACGGCGGTTCCTCGTCCCGGACGGG
CACAGCAACCACAGACTCCCGGTACGGATGCTGGGCGTCTCCATCGATGTATCCCCCGCCGAGGCCCAGCCTCTC
CGCGACCTCGACCCGCTGCTCTTCATGGGCTGTCATCCGGAGACGGGCCACTTCCTCTGGGTGTCGATCCTAGAC
ACGCCCGACACCAACGGTTCTCGCGGGACGGCAGGCGAATACTACCGCATCCAGGTCATCATCTCATGGCTCGCA
CACGTGGACGGCAACGACAGCCCAGCAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACA
TCAACAACAACATCAACGAAAACGACAAGCGACGGCAGCCGCCTAGCCGAGATGAAGCGACGATCAACAGGCTTT
CACCCCCGCCTACGAAGCCTCATCGAATCCATCCCCCCCTCAACAGTCGTAACAGAAATCGCCCTCCAAGACTGG
CCCTGCCACCAAGCATGGAACAACCACGCCGGAAGAGTAACATTGGTAGGCGACGCCGCCCACGCAATGACCATG
TACCGCGGCGAAGCGGCCAACCACGGCATCCTCGACGTCTGGCACCTCTCTCGCGCCATGAGCAGCCAGCACCAC
CAACCACAAGCGCAAGCCGTGGCCGCCTACGAAGCCGAGATGCGGGCGCGCGCCGTCCCCGCCGTCCTGCTCAGC
CGACAGGCCTGCCTCGACGCCCACGATTACCACGCCCTGGACGAGAACTCGGCCCTTTTGAAGAGGCGCGCCCTG
CAGGCTGCCGAGTGA
Transcript >Ophcf2|00564
ATGGACGACCACCGCGTCATCATCTGCGGCGCAGGCATCAGCGGCCTCGTGCTCGCCCACGCATTGGCCAAGGCC
GGCATCGCCTTCGACGTCTACGAGCGCGATGAGCACATCAACGCCCGTCTCCATGGCTGGGGCATCACCTTCCAC
TGGGCTCTCCCGTACCTGAGGGAGATGCTAGATGAGGAGACACTTGCAGCCATAGACGACGTCCAGGTTGATCCC
GAGGTCGGCCGCCACGACACGGGCAACTTCCTGTTCCTCAACCTGGCAAGCCTCGACGTCAAGTTCAAGGTACCG
CCCAACGAGCGCCGACGGGTCAACCGCCAGCGGCTTCGAGAGGCACTCGTCCGGGGCGTCGCCGACCGCGTCCAT
TGGGGCAAACGTCTGGTGGACATCGAGCCCCTGACCGGCTCGACCCTCGTCCGCGCCGTCTTCGCCGACGGGACC
GACGTCCGCGGCCGGCTGCTGGTTGGCGCCGACGGTACCGGCTCACTTACACGGCGGTTCCTCGTCCCGGACGGG
CACAGCAACCACAGACTCCCGGTACGGATGCTGGGCGTCTCCATCGATGTATCCCCCGCCGAGGCCCAGCCTCTC
CGCGACCTCGACCCGCTGCTCTTCATGGGCTGTCATCCGGAGACGGGCCACTTCCTCTGGGTGTCGATCCTAGAC
ACGCCCGACACCAACGGTTCTCGCGGGACGGCAGGCGAATACTACCGCATCCAGGTCATCATCTCATGGCTCGCA
CACGTGGACGGCAACGACAGCCCAGCAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACA
TCAACAACAACATCAACGAAAACGACAAGCGACGGCAGCCGCCTAGCCGAGATGAAGCGACGATCAACAGGCTTT
CACCCCCGCCTACGAAGCCTCATCGAATCCATCCCCCCCTCAACAGTCGTAACAGAAATCGCCCTCCAAGACTGG
CCCTGCCACCAAGCATGGAACAACCACGCCGGAAGAGTAACATTGGTAGGCGACGCCGCCCACGCAATGACCATG
TACCGCGGCGAAGCGGCCAACCACGGCATCCTCGACGTCTGGCACCTCTCTCGCGCCATGAGCAGCCAGCACCAC
CAACCACAAGCGCAAGCCGTGGCCGCCTACGAAGCCGAGATGCGGGCGCGCGCCGTCCCCGCCGTCCTGCTCAGC
CGACAGGCCTGCCTCGACGCCCACGATTACCACGCCCTGGACGAGAACTCGGCCCTTTTGAAGAGGCGCGCCCTG
CAGGCTGCCGAGTGA
Gene >Ophcf2|00564
ATGGACGACCACCGCGTCATCATCTGCGGCGCAGGCATCAGCGGCCTCGTGCTCGCCCACGCATTGGCCAAGGTA
TGACGACGAAGACGACGATGAAAAGAAAAAAAGAAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAACCCCACCCAA
AAATGTCTCTGGGCTGACGTATCTTCCCGCGGAGCAGGCCGGCATCGCCTTCGACGTCTACGAGCGCGATGAGCA
CATCAACGCCCGTCTCCATGGCTGGGGCATCACCTTCCACTGGGCTCTCCCGTACCTGAGGGAGATGCTAGATGA
GGAGACACTTGCAGCCATAGACGACGTCCAGGTTGATCCCGAGGTCGGCCGCCACGACACGGGCAACTTCCTGTT
CCTCAACCTGGCAAGCCTCGACGTCAAGTTCAAGGTACCGCCCAACGAGCGCCGACGGGTCAACCGCCAGCGGCT
TCGAGAGGCACTCGTCCGGGGCGTCGCCGACCGCGTCCATTGGGGCAAACGTCTGGTGGACATCGAGCCCCTGAC
CGGCTCGACCCTCGTCCGCGCCGTCTTCGCCGACGGGACCGACGTCCGCGGCCGGCTGCTGGTTGGCGCCGACGG
TACCGGCTCACTTACACGGCGGTTCCTCGTCCCGGACGGGCACAGCAACCACAGACTCCCGGTACGGATGCTGGG
CGTCTCCATCGATGTATCCCCCGCCGAGGCCCAGCCTCTCCGCGACCTCGACCCGCTGCTCTTCATGGGCTGTCA
TCCGGAGACGGGCCACTTCCTCTGGGTGTCGATCCTAGACACGCCCGACACCAACGGTTCTCGCGGGACGGCAGG
CGAATACTACCGCATCCAGGTCATCATCTCATGGCTCGCACACGTGGACGGCAACGACAGCCCAGCAACAACAAC
AACAACAACAACAACAACAACAACAACAACAACAACAACATCAACAACAACATCAACGAAAACGACAAGCGACGG
CAGCCGCCTAGCCGAGATGAAGCGACGATCAACAGGCTTTCACCCCCGCCTACGAAGCCTCATCGAATCCATCCC
CCCCTCAACAGTCGTAACAGAAATCGCCCTCCAAGACTGGCCCTGCCACCAAGCATGGAACAACCACGCCGGAAG
AGTAACATTGGTAGGCGACGCCGCCCACGCAATGACCATGTACCGCGGCGAAGCGGCCAACCACGGCATCCTCGA
CGTCTGGCACCTCTCTCGCGCCATGAGCAGCCAGCACCACCAACCACAAGCGCAAGCCGTGGCCGCCTACGAAGC
CGAGATGCGGGCGCGCGCCGTCCCCGCCGTCCTGCTCAGCCGACAGGCCTGCCTCGACGCCCACGATTACCACGC
CCTGGACGAGAACTCGGCCCTTTTGAAGAGGCGCGCCCTGCAGGCTGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail