Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00563
Gene name
Locationscaffold_01:2243057..2244689
Strand+
Gene length (bp)1632
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09729 Gti1_Pac2 Gti1/Pac2 family 5.6E-36 3 84

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3074 0.9502 0.0363 0.0356 0.0534 0.002 0.0367 0.0902 0.0193 0.0115

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3007
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5974
Ophiocordyceps australis map64 (Brazil) OphauB2|2842
Ophiocordyceps camponoti-floridani Ophcf2|00563 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|827
Ophiocordyceps kimflemingae Ophio5|1213
Ophiocordyceps subramaniannii Hirsu2|5181

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00563
METYHGYVRAPADAIKLFEACRLGLLPRVQRRLSEKERQSIRSGSVFVWDEREAGMRRWTDGKSWSASRVSGSFL
TYREMEGKRGGGFGGGGGGGAAGAGGNRRGGAGKTPDSGRGSDEDHDDGEPEGYRYKADGLMKQSFSLTTTTGQH
LHLISYYTRPHAGQPELPQPTNDANLRHVVPPKGMYPESSMGESNQTPAMTRAPMQQAYMQQPQQPHHYPSYAGY
GWPPSPAATPPYGQYPYAAMNPQQQQQQQQQQQQQQQQQQQHQQQQQQQQQHQQHQQHQQHQQHQQHQQHQQHQQ
QQHHHHHHQQLSLQHGQLQHGHPPPPPPPPPPSSHAQHQHHVQQLQQHAHHHHHHHHHHQQHPPPPPPPPAPHHH
HSHHHHPPQHYAHYTHAPPPSATPAPPVQTNKHPYPGPQHHGHHHPRLHDSPRQKKLQAAAQAVMCDPQLAAKSL
PALNSVMATPPARHLSVTPPRSSAAASSHATTTRPSLSALLHPTPASSEPGSAKTVSSGSAGSSPRTAGVVLDKS
GASEDVRALRMLDRKFCI*
Coding >Ophcf2|00563
ATGGAGACGTATCACGGCTACGTGCGGGCGCCCGCCGACGCCATCAAGCTGTTCGAGGCCTGCCGTCTCGGTCTC
TTGCCGCGTGTTCAGCGGAGGCTATCCGAGAAGGAGAGGCAGTCGATCCGCTCCGGCTCCGTTTTCGTATGGGAC
GAGCGCGAGGCTGGCATGAGGCGCTGGACCGATGGCAAGTCGTGGAGCGCCAGCCGCGTCTCAGGCAGCTTTTTG
ACCTATCGCGAGATGGAGGGCAAACGAGGCGGAGGATTCGGAGGAGGCGGGGGAGGGGGAGCAGCCGGAGCAGGA
GGCAACCGCCGGGGAGGAGCCGGAAAGACGCCCGACTCAGGTCGCGGTAGCGACGAGGATCACGACGACGGAGAG
CCCGAGGGCTACCGATACAAGGCAGACGGCCTGATGAAGCAGTCGTTCAGCTTGACGACGACGACGGGCCAGCAC
CTCCACCTCATCTCGTACTACACCCGTCCGCACGCCGGCCAGCCCGAGCTGCCCCAGCCGACAAACGACGCCAAT
CTTCGCCATGTGGTGCCTCCCAAGGGCATGTATCCCGAGTCGAGCATGGGCGAGTCCAACCAGACGCCGGCCATG
ACGAGGGCTCCGATGCAACAGGCCTACATGCAGCAGCCGCAGCAGCCGCATCACTATCCTTCGTATGCTGGCTAT
GGCTGGCCGCCCTCGCCCGCTGCTACGCCGCCGTACGGGCAGTATCCCTACGCGGCCATGAATCCTCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAACAGCAACAGCAACAGCAACACCAGCAGCAGCAGCAGCAGCAGCAG
CAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAA
CAACAACACCACCACCACCACCACCAGCAGCTTTCTCTGCAGCACGGTCAACTCCAGCACGGGCATCCTCCTCCA
CCGCCACCGCCACCTCCTCCCTCATCTCACGCCCAACATCAACACCATGTACAACAACTACAGCAACATGCACAC
CACCACCATCACCACCATCACCACCATCAACAGCATCCACCACCTCCGCCGCCACCACCTGCTCCTCACCACCAC
CACAGCCACCACCATCACCCTCCTCAGCACTACGCCCACTACACCCACGCTCCCCCCCCGAGCGCAACCCCTGCC
CCGCCGGTGCAGACGAATAAGCACCCCTATCCGGGCCCTCAGCACCACGGCCACCACCACCCGCGATTGCACGAC
TCGCCGCGGCAGAAGAAGCTGCAGGCAGCAGCTCAGGCCGTCATGTGCGATCCCCAGCTGGCTGCCAAGTCCCTA
CCGGCCCTCAACTCGGTCATGGCCACGCCTCCCGCTCGCCATCTCAGCGTGACGCCTCCCCGATCTTCGGCGGCC
GCCTCGTCTCATGCTACGACGACGAGACCTAGCCTCTCGGCACTCCTGCATCCGACGCCCGCCAGTAGCGAGCCG
GGCAGTGCCAAGACGGTCAGCAGCGGGAGCGCGGGAAGCAGCCCTCGAACGGCTGGCGTCGTTCTCGACAAGTCC
GGGGCTAGCGAGGACGTGCGAGCACTGAGGATGCTGGATCGCAAGTTTTGCATCTAG
Transcript >Ophcf2|00563
ATGGAGACGTATCACGGCTACGTGCGGGCGCCCGCCGACGCCATCAAGCTGTTCGAGGCCTGCCGTCTCGGTCTC
TTGCCGCGTGTTCAGCGGAGGCTATCCGAGAAGGAGAGGCAGTCGATCCGCTCCGGCTCCGTTTTCGTATGGGAC
GAGCGCGAGGCTGGCATGAGGCGCTGGACCGATGGCAAGTCGTGGAGCGCCAGCCGCGTCTCAGGCAGCTTTTTG
ACCTATCGCGAGATGGAGGGCAAACGAGGCGGAGGATTCGGAGGAGGCGGGGGAGGGGGAGCAGCCGGAGCAGGA
GGCAACCGCCGGGGAGGAGCCGGAAAGACGCCCGACTCAGGTCGCGGTAGCGACGAGGATCACGACGACGGAGAG
CCCGAGGGCTACCGATACAAGGCAGACGGCCTGATGAAGCAGTCGTTCAGCTTGACGACGACGACGGGCCAGCAC
CTCCACCTCATCTCGTACTACACCCGTCCGCACGCCGGCCAGCCCGAGCTGCCCCAGCCGACAAACGACGCCAAT
CTTCGCCATGTGGTGCCTCCCAAGGGCATGTATCCCGAGTCGAGCATGGGCGAGTCCAACCAGACGCCGGCCATG
ACGAGGGCTCCGATGCAACAGGCCTACATGCAGCAGCCGCAGCAGCCGCATCACTATCCTTCGTATGCTGGCTAT
GGCTGGCCGCCCTCGCCCGCTGCTACGCCGCCGTACGGGCAGTATCCCTACGCGGCCATGAATCCTCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAACAGCAACAGCAACAGCAACACCAGCAGCAGCAGCAGCAGCAGCAG
CAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAA
CAACAACACCACCACCACCACCACCAGCAGCTTTCTCTGCAGCACGGTCAACTCCAGCACGGGCATCCTCCTCCA
CCGCCACCGCCACCTCCTCCCTCATCTCACGCCCAACATCAACACCATGTACAACAACTACAGCAACATGCACAC
CACCACCATCACCACCATCACCACCATCAACAGCATCCACCACCTCCGCCGCCACCACCTGCTCCTCACCACCAC
CACAGCCACCACCATCACCCTCCTCAGCACTACGCCCACTACACCCACGCTCCCCCCCCGAGCGCAACCCCTGCC
CCGCCGGTGCAGACGAATAAGCACCCCTATCCGGGCCCTCAGCACCACGGCCACCACCACCCGCGATTGCACGAC
TCGCCGCGGCAGAAGAAGCTGCAGGCAGCAGCTCAGGCCGTCATGTGCGATCCCCAGCTGGCTGCCAAGTCCCTA
CCGGCCCTCAACTCGGTCATGGCCACGCCTCCCGCTCGCCATCTCAGCGTGACGCCTCCCCGATCTTCGGCGGCC
GCCTCGTCTCATGCTACGACGACGAGACCTAGCCTCTCGGCACTCCTGCATCCGACGCCCGCCAGTAGCGAGCCG
GGCAGTGCCAAGACGGTCAGCAGCGGGAGCGCGGGAAGCAGCCCTCGAACGGCTGGCGTCGTTCTCGACAAGTCC
GGGGCTAGCGAGGACGTGCGAGCACTGAGGATGCTGGATCGCAAGTTTTGCATCTAG
Gene >Ophcf2|00563
ATGGAGACGTATCACGGCTACGTGCGGGCGCCCGCCGACGCCATCAAGCTGTTCGAGGCCTGCCGTCTCGGTCTC
TTGCCGCGTGTTCAGCGGAGGCTATCCGAGAAGGAGAGGCAGTCGATCCGCTCCGGCTCCGTTTTCGTATGGGAC
GAGCGCGAGGCTGGCATGAGGCGCTGGACCGATGGCAAGTCGTGGAGCGCCAGCCGCGTCTCAGGCAGCTTTTTG
ACCTATCGCGAGATGGAGGGCAAACGAGGCGGAGGATTCGGAGGAGGCGGGGGAGGGGGAGCAGCCGGAGCAGGA
GGCAACCGCCGGGGAGGAGCCGGAAAGACGCCCGACTCAGGTCGCGGTAGCGACGAGGATCACGACGACGGAGAG
CCCGAGGGCTACCGATACAAGGCAGACGGCCTGATGAAGCAGTCGTTCAGCTTGACGACGACGACGGGCCAGCAC
CTCCACCTCATCTCGTACTACACCCGTCCGCACGCCGGCCAGCCCGAGCTGCCCCAGCCGACAAACGACGCCAAT
CTTCGCCATGTGGTGCCTCCCAAGGGCATGTATCCCGAGTCGAGCATGGGCGAGTCCAACCAGACGCCGGCCATG
ACGAGGGCTCCGATGCAACAGGCCTACATGCAGCAGCCGCAGCAGCCGCATCACTATCCTTCGTATGCTGGCTAT
GGCTGGCCGCCCTCGCCCGCTGCTACGCCGCCGTACGGGCAGTATCCCTACGCGGCCATGAATCCTCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAACAGCAACAGCAACAGCAACACCAGCAGCAGCAGCAGCAGCAGCAG
CAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAACACCAGCAA
CAACAACACCACCACCACCACCACCAGCAGCTTTCTCTGCAGCACGGTCAACTCCAGCACGGGCATCCTCCTCCA
CCGCCACCGCCACCTCCTCCCTCATCTCACGCCCAACATCAACACCATGTACAACAACTACAGCAACATGCACAC
CACCACCATCACCACCATCACCACCATCAACAGCATCCACCACCTCCGCCGCCACCACCTGCTCCTCACCACCAC
CACAGCCACCACCATCACCCTCCTCAGCACTACGCCCACTACACCCACGCTCCCCCCCCGAGCGCAACCCCTGCC
CCGCCGGTGCAGACGAATAAGCACCCCTATCCGGGCCCTCAGCACCACGGCCACCACCACCCGCGATTGCACGAC
TCGCCGCGGCAGAAGAAGCTGCAGGCAGCAGCTCAGGCCGTCATGTGCGATCCCCAGCTGGCTGCCAAGTCCCTA
CCGGCCCTCAACTCGGTCATGGCCACGCCTCCCGCTCGCCATCTCAGCGTGACGCCTCCCCGATCTTCGGCGGCC
GCCTCGTCTCATGCTACGACGACGAGACCTAGCCTCTCGGCACTCCTGCATCCGACGCCCGCCAGTAGCGAGCCG
GGCAGTGCCAAGACGGTCAGCAGCGGGAGCGCGGGAAGCAGCCCTCGAACGGCTGGCGTCGTTCTCGACAAGTCC
GGGGCTAGCGAGGACGTGCGAGCACTGAGGATGCTGGATCGCAAGTTTTGCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail