Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00561
Gene name
Locationscaffold_01:2233024..2234029
Strand-
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263) 3.1E-09 70 157

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6566 0.5088 0.1043 0.0678 0.263 0.0307 0.0513 0.1869 0.2309 0.0261

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1701
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1879
Ophiocordyceps australis map64 (Brazil) OphauB2|7627
Ophiocordyceps camponoti-floridani Ophcf2|00561 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1368
Ophiocordyceps kimflemingae Ophio5|1089
Ophiocordyceps subramaniannii Hirsu2|1493

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00561
MAPASRSGRVRPAEVAAETKRNFIPLIRAHHSHEFPPYSVLYRQPVTQLAIQRRVPSTRPPVFRFVAGDPVMAAE
SYGASDSLTSEQQVRIPFICAANEKRPGGDWETGCSGYEEKLCRRSNLSATLGTPDPATGERSNYPIPTSGGILS
DSVVVWRGPHDRYDQLDDWYNLPIVSVPPIRWPKLRDNGTRYSFSTERDMMRDKMRGALRICLYHGYDRVVIGDF
GLGNSCRNPPRELAEIWRDVFLFDPDMRGQFVYVVFAFEDAEQSTVRLILDEIEKRNRNGAGPRPEPSTAPGPPP
PTDMAIFQLVFADSEIERVLSAPDPRYDLNMITS*
Coding >Ophcf2|00561
ATGGCGCCGGCTTCCAGGTCCGGCAGGGTCAGGCCAGCCGAGGTGGCGGCCGAGACCAAGAGAAACTTCATACCG
CTCATCAGGGCGCACCACTCGCACGAGTTCCCTCCCTACTCGGTGCTATACCGACAGCCGGTGACGCAGTTGGCC
ATCCAGAGACGGGTGCCGAGCACGCGGCCTCCCGTCTTCCGCTTCGTGGCCGGCGATCCCGTCATGGCTGCCGAG
TCGTACGGGGCGTCCGACAGCCTGACCAGCGAACAACAGGTGCGGATCCCCTTCATCTGCGCCGCCAACGAGAAG
CGGCCCGGAGGCGACTGGGAGACGGGCTGCTCGGGCTACGAAGAGAAGCTCTGCCGGCGAAGCAACCTATCGGCG
ACTCTCGGCACGCCGGACCCAGCCACGGGAGAGAGGTCCAACTACCCAATCCCAACCTCTGGCGGCATCCTGTCC
GACTCGGTCGTCGTCTGGCGCGGACCCCACGATCGTTACGACCAGCTAGATGACTGGTATAACCTGCCCATCGTG
TCCGTGCCTCCGATCCGGTGGCCCAAACTCAGGGACAATGGGACCAGATATTCCTTCTCTACGGAACGCGACATG
ATGCGCGACAAGATGCGCGGCGCCCTCCGCATCTGTCTCTACCACGGCTATGACCGCGTTGTCATCGGAGACTTT
GGGCTCGGCAATAGCTGCCGCAACCCTCCTCGGGAACTGGCCGAGATCTGGCGCGACGTATTCCTCTTCGACCCA
GATATGCGCGGCCAGTTCGTCTACGTCGTCTTCGCCTTCGAGGACGCCGAACAGAGCACCGTCCGCCTGATCCTC
GACGAGATTGAAAAGAGGAACCGTAACGGCGCCGGCCCCAGGCCCGAACCGTCCACCGCTCCGGGACCCCCCCCT
CCGACTGATATGGCCATCTTTCAGCTCGTCTTTGCAGACTCGGAGATTGAACGCGTCCTCAGCGCTCCTGACCCG
CGCTACGACCTCAACATGATTACTTCCTGA
Transcript >Ophcf2|00561
ATGGCGCCGGCTTCCAGGTCCGGCAGGGTCAGGCCAGCCGAGGTGGCGGCCGAGACCAAGAGAAACTTCATACCG
CTCATCAGGGCGCACCACTCGCACGAGTTCCCTCCCTACTCGGTGCTATACCGACAGCCGGTGACGCAGTTGGCC
ATCCAGAGACGGGTGCCGAGCACGCGGCCTCCCGTCTTCCGCTTCGTGGCCGGCGATCCCGTCATGGCTGCCGAG
TCGTACGGGGCGTCCGACAGCCTGACCAGCGAACAACAGGTGCGGATCCCCTTCATCTGCGCCGCCAACGAGAAG
CGGCCCGGAGGCGACTGGGAGACGGGCTGCTCGGGCTACGAAGAGAAGCTCTGCCGGCGAAGCAACCTATCGGCG
ACTCTCGGCACGCCGGACCCAGCCACGGGAGAGAGGTCCAACTACCCAATCCCAACCTCTGGCGGCATCCTGTCC
GACTCGGTCGTCGTCTGGCGCGGACCCCACGATCGTTACGACCAGCTAGATGACTGGTATAACCTGCCCATCGTG
TCCGTGCCTCCGATCCGGTGGCCCAAACTCAGGGACAATGGGACCAGATATTCCTTCTCTACGGAACGCGACATG
ATGCGCGACAAGATGCGCGGCGCCCTCCGCATCTGTCTCTACCACGGCTATGACCGCGTTGTCATCGGAGACTTT
GGGCTCGGCAATAGCTGCCGCAACCCTCCTCGGGAACTGGCCGAGATCTGGCGCGACGTATTCCTCTTCGACCCA
GATATGCGCGGCCAGTTCGTCTACGTCGTCTTCGCCTTCGAGGACGCCGAACAGAGCACCGTCCGCCTGATCCTC
GACGAGATTGAAAAGAGGAACCGTAACGGCGCCGGCCCCAGGCCCGAACCGTCCACCGCTCCGGGACCCCCCCCT
CCGACTGATATGGCCATCTTTCAGCTCGTCTTTGCAGACTCGGAGATTGAACGCGTCCTCAGCGCTCCTGACCCG
CGCTACGACCTCAACATGATTACTTCCTGA
Gene >Ophcf2|00561
ATGGCGCCGGCTTCCAGGTCCGGCAGGGTCAGGCCAGCCGAGGTGGCGGCCGAGACCAAGAGAAACTTCATACCG
CTCATCAGGGCGCACCACTCGCACGAGTTCCCTCCCTACTCGGTGCTATACCGACAGCCGGTGACGCAGTTGGCC
ATCCAGAGACGGGTGCCGAGCACGCGGCCTCCCGTCTTCCGCTTCGTGGCCGGCGATCCCGTCATGGCTGCCGAG
TCGTACGGGGCGTCCGACAGCCTGACCAGCGAACAACAGGTGCGGATCCCCTTCATCTGCGCCGCCAACGAGAAG
CGGCCCGGAGGCGACTGGGAGACGGGCTGCTCGGGCTACGAAGAGAAGCTCTGCCGGCGAAGCAACCTATCGGCG
ACTCTCGGCACGCCGGACCCAGCCACGGGAGAGAGGTCCAACTACCCAATCCCAACCTCTGGCGGCATCCTGTCC
GACTCGGTCGTCGTCTGGCGCGGACCCCACGATCGTTACGACCAGCTAGATGACTGGTATAACCTGCCCATCGTG
TCCGTGCCTCCGATCCGGTGGCCCAAACTCAGGGACAATGGGACCAGATATTCCTTCTCTACGGAACGCGACATG
ATGCGCGACAAGATGCGCGGCGCCCTCCGCATCTGTCTCTACCACGGCTATGACCGCGTTGTCATCGGAGACTTT
GGGCTCGGCAATAGCTGCCGCAACCCTCCTCGGGAACTGGCCGAGATCTGGCGCGACGTATTCCTCTTCGACCCA
GATATGCGCGGCCAGTTCGTCTACGTCGTCTTCGCCTTCGAGGACGCCGAACAGAGCACCGTCCGCCTGATCCTC
GACGAGATTGAAAAGAGGAACCGTAACGGCGCCGGCCCCAGGCCCGAACCGTCCACCGCTCCGGGACCCCCCCCT
CCGACTGATATGGCCATCTTTCAGCTCGTCTTTGCAGACTCGGAGATTGAACGCGTCCTCAGCGCTCCTGACCCG
CGCTACGACCTCAACATGATTACTTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail