Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00558
Gene name
Locationscaffold_01:2223554..2224433
Strand-
Gene length (bp)879
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00538 Linker_histone linker histone H1 and H5 family 2.7E-28 19 91

GO

GO Term Description Terminal node
GO:0000786 nucleosome Yes
GO:0006334 nucleosome assembly Yes
GO:0003677 DNA binding Yes
GO:0005575 cellular_component No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:0032993 protein-DNA complex No
GO:0065003 protein-containing complex assembly No
GO:1901363 heterocyclic compound binding No
GO:0071840 cellular component organization or biogenesis No
GO:0005488 binding No
GO:0032991 protein-containing complex No
GO:0043933 protein-containing complex organization No
GO:0044815 DNA packaging complex No
GO:0034728 nucleosome organization No
GO:0006325 chromatin organization No
GO:0003674 molecular_function No
GO:0065004 protein-DNA complex assembly No
GO:0006338 chromatin remodeling No
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0008150 biological_process No
GO:0071824 protein-DNA complex subunit organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3647 0.6922 0.2683 0.1505 0.2077 0.2008 0.0468 0.0025 0.0688 0.0006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1703
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1881
Ophiocordyceps australis map64 (Brazil) OphauB2|7625
Ophiocordyceps camponoti-floridani Ophcf2|00558 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5044
Ophiocordyceps kimflemingae Ophio5|166
Ophiocordyceps subramaniannii Hirsu2|1497

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00558
MPPKKVEAAKPATKPAPAHASYQDMIIDAIVNLKDRNGSSRQSLKKYVKANNQLNVSDNMFDSLFNKALKNGVEK
GVFAQPKGPSGGTKLAKKKAEPKKPVVKKTEGAPKKAAPKKAASAPKKAAAPAPKKAATTTPKKTATPKKAASVA
TAAAAAAPKPEKPETVMTKTKSGRVTKTVKPAATKKATPKKTTSRKVSGSAAKA*
Coding >Ophcf2|00558
ATGCCCCCCAAGAAGGTCGAGGCCGCGAAGCCGGCCACCAAGCCTGCGCCTGCTCACGCCAGTTACCAGGACATG
ATTATCGATGCCATCGTCAACCTTAAGGATCGCAACGGTTCCAGTCGGCAGTCCCTGAAGAAGTATGTCAAGGCA
AACAACCAGCTCAACGTGTCGGACAACATGTTCGACTCTCTGTTCAACAAGGCGCTCAAGAATGGCGTCGAAAAG
GGCGTCTTTGCCCAACCCAAGGGTCCCTCCGGCGGCACCAAGCTTGCCAAGAAAAAGGCCGAACCCAAGAAGCCT
GTTGTGAAGAAGACCGAGGGTGCGCCCAAGAAGGCCGCGCCAAAGAAGGCCGCCTCTGCGCCAAAAAAGGCTGCT
GCTCCAGCCCCAAAGAAGGCTGCTACCACCACCCCCAAGAAGACGGCGACCCCGAAAAAGGCTGCTTCCGTCGCC
ACCGCCGCCGCCGCCGCTGCTCCCAAGCCCGAAAAGCCCGAGACTGTTATGACCAAGACTAAGTCTGGCCGCGTG
ACCAAGACAGTAAAGCCAGCCGCGACCAAGAAGGCGACGCCCAAGAAGACGACATCCAGAAAGGTTTCGGGATCC
GCCGCCAAGGCGTAA
Transcript >Ophcf2|00558
ATGCCCCCCAAGAAGGTCGAGGCCGCGAAGCCGGCCACCAAGCCTGCGCCTGCTCACGCCAGTTACCAGGACATG
ATTATCGATGCCATCGTCAACCTTAAGGATCGCAACGGTTCCAGTCGGCAGTCCCTGAAGAAGTATGTCAAGGCA
AACAACCAGCTCAACGTGTCGGACAACATGTTCGACTCTCTGTTCAACAAGGCGCTCAAGAATGGCGTCGAAAAG
GGCGTCTTTGCCCAACCCAAGGGTCCCTCCGGCGGCACCAAGCTTGCCAAGAAAAAGGCCGAACCCAAGAAGCCT
GTTGTGAAGAAGACCGAGGGTGCGCCCAAGAAGGCCGCGCCAAAGAAGGCCGCCTCTGCGCCAAAAAAGGCTGCT
GCTCCAGCCCCAAAGAAGGCTGCTACCACCACCCCCAAGAAGACGGCGACCCCGAAAAAGGCTGCTTCCGTCGCC
ACCGCCGCCGCCGCCGCTGCTCCCAAGCCCGAAAAGCCCGAGACTGTTATGACCAAGACTAAGTCTGGCCGCGTG
ACCAAGACAGTAAAGCCAGCCGCGACCAAGAAGGCGACGCCCAAGAAGACGACATCCAGAAAGGTTTCGGGATCC
GCCGCCAAGGCGTAA
Gene >Ophcf2|00558
ATGCCCCCCAAGAAGGTCGAGGCCGCGAAGCCGGCCACCAAGCCTGCGCCTGCTCACGCCAGTTACCAGGTTCGC
CGCATTCTCCGTCGTCTTTGTCGCGTCTTGACTAACTCGCTGCAGGACATGATTATCGATGCCATCGTCAACGTA
TGTTGTTCTTCTGGCGCATCTGGTTTCCCCGCCCGGGTGACGCGTTCATCACCTGCATGTCGACGTGTGCTGACG
CCTTAGCCTACCTACAGCTTAAGGATCGCAACGGTTCCAGGTGTGTGTTGACGCGAATGTCTTCTCCCGTCTAAC
GGTCGCTAATCCTCTTTGCAGTCGGCAGTCCCTGAAGAAGTATGTCAAGGCAAACAACCAGCTCAACGTGTCGGA
CAACATGTTCGACTCTCTGTTCAACAAGGCGCTCAAGAATGGCGTCGAAAAGGGCGTCTTTGCCCAACCCAAGGG
TCCCTCCGGCGGCACCAAGCTTGCCAAGAAAAAGGCCGAACCCAAGAAGCCTGTTGTGAAGAAGACCGAGGGTGC
GCCCAAGAAGGCCGCGCCAAAGAAGGCCGCCTCTGCGCCAAAAAAGGCTGCTGCTCCAGCCCCAAAGAAGGCTGC
TACCACCACCCCCAAGAAGACGGCGACCCCGAAAAAGGCTGCTTCCGTCGCCACCGCCGCCGCCGCCGCTGCTCC
CAAGGTGAGTTTCGTGTCGCGACTCTCCGGCGTCTTCCGTACATCGACTAACTTGTCTTCGCACAGCCCGAAAAG
CCCGAGACTGTTATGACCAAGACTAAGTCTGGCCGCGTGACCAAGACAGTAAAGCCAGCCGCGACCAAGAAGGCG
ACGCCCAAGAAGACGACATCCAGAAAGGTTTCGGGATCCGCCGCCAAGGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail