Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00548
Gene name
Locationscaffold_01:2196566..2197874
Strand+
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 3.6E-46 194 374

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1061 0.0956 0.0559 0.0583 0.7608 0.0384 0.0796 0.0479 0.192 0.0036

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6518
Ophiocordyceps australis map64 (Brazil) OphauB2|7616
Ophiocordyceps camponoti-floridani Ophcf2|00548 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3378
Ophiocordyceps kimflemingae Ophio5|4815
Ophiocordyceps subramaniannii Hirsu2|2065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00548
MSVAPQRTALINVSRTITSASAARPPNGRHVQPRAWLATTRRRLKFPSQGRGGGGGSSRHHSSPPSPSPSPSPSQ
KQDHQDETSTIEAGGGKRKAQRVKPRKNSLLRLAIDAQKAKEHGSGDKMATEQPSAAAHEDSSEEPSSMTISATC
VAEAFDMPLVVDILTSHGFALDPDRTGFVSGDVVHARSANGSDIFVFPSGTVVTWSLPVDAVTGQLMRAAEHPHK
PDLCEAEDLEFTVDPSKADSTMKGDLVILGTQREHTEGTPLDTTLAKVAFSSGLARSTKLAVLENTLDAYLESTR
NIPSLFSRGSAASLGRRFILQKTGELLSLRARLNHYWELTDVLPDILWENEGLDNYYETVGRALDVRTRIKVLNQ
KMDYAQEIATVLREVASERHGTRLELIIIVLIAVEVVFEVRRIYLESVEGREPSVEADAR*
Coding >Ophcf2|00548
ATGAGCGTTGCTCCGCAGAGGACAGCCCTCATCAATGTGTCCCGTACCATCACTTCTGCCTCGGCAGCACGTCCT
CCCAACGGAAGACACGTCCAGCCACGGGCATGGCTGGCCACGACTCGACGACGGTTGAAGTTTCCAAGCCAAGGC
CGTGGCGGCGGCGGCGGCTCGTCTCGTCATCATTCGTCTCCCCCTTCACCTTCACCTTCACCATCGCCCTCGCAG
AAGCAAGATCACCAGGATGAGACGTCGACTATCGAGGCCGGCGGTGGAAAGCGCAAAGCACAAAGAGTGAAACCA
CGAAAGAACTCACTGCTGAGGCTCGCCATCGACGCCCAAAAGGCCAAGGAGCACGGCTCCGGCGACAAGATGGCT
ACCGAGCAGCCATCCGCCGCCGCGCACGAGGACTCGTCAGAGGAACCATCATCCATGACCATCAGCGCCACATGC
GTAGCCGAGGCCTTCGACATGCCCCTCGTCGTCGACATCCTCACCTCGCATGGCTTCGCCCTCGATCCCGACCGC
ACAGGCTTCGTTTCAGGCGACGTGGTCCACGCCCGGTCCGCCAATGGCAGTGACATCTTCGTCTTCCCCTCCGGC
ACGGTCGTCACCTGGTCGTTGCCCGTCGATGCCGTGACCGGGCAGCTGATGCGCGCTGCTGAGCACCCCCACAAG
CCCGACCTCTGCGAGGCCGAAGACCTCGAGTTCACCGTCGACCCGTCCAAGGCCGACAGTACCATGAAGGGCGAC
CTCGTCATCCTCGGCACTCAACGCGAGCACACCGAGGGCACCCCCCTCGACACGACGCTCGCAAAGGTAGCCTTC
TCGTCCGGCCTCGCCCGCAGCACCAAGCTAGCCGTGCTGGAGAACACCCTGGATGCCTACCTCGAAAGCACGAGG
AACATCCCCTCCCTCTTCTCCCGCGGCTCCGCCGCCTCCCTAGGCCGCCGCTTCATCCTCCAAAAGACGGGCGAG
CTCCTCAGTCTACGCGCCCGCCTCAACCACTACTGGGAGCTGACCGACGTCCTACCCGACATCCTCTGGGAGAAC
GAGGGTCTCGATAACTACTACGAGACCGTCGGCCGCGCCCTAGACGTGAGAACGCGCATCAAGGTCCTCAACCAG
AAGATGGACTACGCGCAGGAGATAGCCACCGTCCTGCGCGAGGTCGCCAGCGAACGTCACGGCACCCGCCTCGAG
CTCATCATCATCGTCCTCATCGCCGTCGAGGTCGTCTTCGAGGTTCGCCGCATCTATCTCGAGTCCGTCGAGGGG
CGCGAACCATCTGTCGAAGCCGATGCCCGGTGA
Transcript >Ophcf2|00548
ATGAGCGTTGCTCCGCAGAGGACAGCCCTCATCAATGTGTCCCGTACCATCACTTCTGCCTCGGCAGCACGTCCT
CCCAACGGAAGACACGTCCAGCCACGGGCATGGCTGGCCACGACTCGACGACGGTTGAAGTTTCCAAGCCAAGGC
CGTGGCGGCGGCGGCGGCTCGTCTCGTCATCATTCGTCTCCCCCTTCACCTTCACCTTCACCATCGCCCTCGCAG
AAGCAAGATCACCAGGATGAGACGTCGACTATCGAGGCCGGCGGTGGAAAGCGCAAAGCACAAAGAGTGAAACCA
CGAAAGAACTCACTGCTGAGGCTCGCCATCGACGCCCAAAAGGCCAAGGAGCACGGCTCCGGCGACAAGATGGCT
ACCGAGCAGCCATCCGCCGCCGCGCACGAGGACTCGTCAGAGGAACCATCATCCATGACCATCAGCGCCACATGC
GTAGCCGAGGCCTTCGACATGCCCCTCGTCGTCGACATCCTCACCTCGCATGGCTTCGCCCTCGATCCCGACCGC
ACAGGCTTCGTTTCAGGCGACGTGGTCCACGCCCGGTCCGCCAATGGCAGTGACATCTTCGTCTTCCCCTCCGGC
ACGGTCGTCACCTGGTCGTTGCCCGTCGATGCCGTGACCGGGCAGCTGATGCGCGCTGCTGAGCACCCCCACAAG
CCCGACCTCTGCGAGGCCGAAGACCTCGAGTTCACCGTCGACCCGTCCAAGGCCGACAGTACCATGAAGGGCGAC
CTCGTCATCCTCGGCACTCAACGCGAGCACACCGAGGGCACCCCCCTCGACACGACGCTCGCAAAGGTAGCCTTC
TCGTCCGGCCTCGCCCGCAGCACCAAGCTAGCCGTGCTGGAGAACACCCTGGATGCCTACCTCGAAAGCACGAGG
AACATCCCCTCCCTCTTCTCCCGCGGCTCCGCCGCCTCCCTAGGCCGCCGCTTCATCCTCCAAAAGACGGGCGAG
CTCCTCAGTCTACGCGCCCGCCTCAACCACTACTGGGAGCTGACCGACGTCCTACCCGACATCCTCTGGGAGAAC
GAGGGTCTCGATAACTACTACGAGACCGTCGGCCGCGCCCTAGACGTGAGAACGCGCATCAAGGTCCTCAACCAG
AAGATGGACTACGCGCAGGAGATAGCCACCGTCCTGCGCGAGGTCGCCAGCGAACGTCACGGCACCCGCCTCGAG
CTCATCATCATCGTCCTCATCGCCGTCGAGGTCGTCTTCGAGGTTCGCCGCATCTATCTCGAGTCCGTCGAGGGG
CGCGAACCATCTGTCGAAGCCGATGCCCGGTGA
Gene >Ophcf2|00548
ATGAGCGTTGCTCCGCAGAGGACAGCCCTCATCAATGTGTCCCGTACCATCACTTCTGCCTCGGCAGCACGTCCT
CCCAACGGAAGACACGTCCAGCCACGGGCATGGCTGGCCACGACTCGACGACGGTTGAAGTTTCCAAGCCAAGGC
CGTGGCGGCGGCGGCGGCTCGTCTCGTCATCATTCGTCTCCCCCTTCACCTTCACCTTCACCATCGCCCTCGCAG
AAGCAAGATCACCAGGATGAGACGTCGACTATCGAGGCCGGCGGTGGAAAGCGCAAAGCACAAAGAGTGAAACCA
CGAAAGAACTCACTGCTGAGGCTCGCCATCGACGCCCAAAAGGCCAAGGAGCACGGCTCCGGCGACAAGATGGCT
ACCGAGCAGCCATCCGCCGCCGCGCACGAGGACTCGTCAGAGGAACCATCATCCATGACCATCAGCGCCACATGC
GTAGCCGAGGCCTTCGACATGCCCCTCGTCGTCGACATCCTCACCTCGCATGGCTTCGCCCTCGATCCCGACCGC
ACAGGCTTCGTTTCAGGCGACGTGGTCCACGCCCGGTCCGCCAATGGCAGTGACATCTTCGTCTTCCCCTCCGGC
ACGGTCGTCACCTGGTCGTTGCCCGTCGATGCCGTGACCGGGCAGCTGATGCGCGCTGCTGAGCACCCCCACAAG
CCCGACCTCTGCGAGGCCGAAGACCTCGAGTTCACCGTCGACCCGTCCAAGGCCGACAGTACCATGAAGGGCGAC
CTCGTCATCCTCGGCACTCAACGCGAGCACACCGAGGGCACCCCCCTCGACACGACGCTCGCAAAGGTAGCCTTC
TCGTCCGGCCTCGCCCGCAGCACCAAGCTAGCCGTGCTGGAGAACACCCTGGATGCCTACCTCGAAAGCACGAGG
AACATCCCCTCCCTCTTCTCCCGCGGCTCCGCCGCCTCCCTAGGCCGCCGCTTCATCCTCCAAAAGACGGGCGAG
CTCCTCAGTCTACGCGCCCGCCTCAACCACTACTGGGAGCTGACCGACGTCCTACCCGACATCCTCTGGGAGAAC
GAGGGTCTCGATAACTACTACGAGACCGTCGGCCGCGCCCTAGACGTGAGAACGCGCATCAAGGTCCTCAACCAG
AAGATGGACTACGCGCAGGAGATAGCCACCGTCCTGCGCGAGGTCGCCAGCGAACGTCACGGCACCCGCCTCGAG
CTCATCATCATCGTCCTCATCGCCGTCGAGGTCGTCTTCGAGGTTCGCCGCATCTATCTCGAGTCCGTCGAGGGG
CGCGAACCATCTGTCGAAGCCGATGCCCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail