Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00536
Gene name
Locationscaffold_01:2170937..2171603
Strand-
Gene length (bp)666
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4564 0.5508 0.3375 0.1854 0.0979 0.0845 0.1082 0.2266 0.0749 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|861
Ophiocordyceps australis map64 (Brazil) OphauB2|7608
Ophiocordyceps camponoti-floridani Ophcf2|00535
Ophiocordyceps camponoti-floridani Ophcf2|00536 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3389
Ophiocordyceps kimflemingae Ophio5|7640
Ophiocordyceps subramaniannii Hirsu2|789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00536
MSHDGIIQLEDKHNFTHWFKQIRAVANGIWLYVDPETTLDVNEPIKPEKTATDMEWEYWKITAQDYNAIEERKKE
LNDIILNTISPQLCREAARCRSPREKIQQIRKSLHLDGEEEKRLAREKYQAIVAKKGRRNWTSWAMEFERAFLDC
KDVNVEGYNDAKARRDFIKCLCASSVPWVASCGVSFSVTDEMTKEEDRASLEEFVRIFRVTADRRFQTMES*
Coding >Ophcf2|00536
ATGAGTCACGATGGGATAATCCAGTTGGAAGACAAACACAACTTCACCCATTGGTTCAAGCAAATCAGGGCTGTA
GCCAACGGTATCTGGCTTTATGTTGACCCAGAGACCACCCTCGATGTCAATGAACCCATCAAACCGGAAAAGACG
GCTACCGACATGGAATGGGAGTACTGGAAGATAACAGCGCAGGATTATAATGCTATCGAGGAGCGAAAGAAGGAG
TTGAACGACATCATCCTGAATACCATCAGCCCGCAGCTCTGCCGTGAAGCAGCCAGGTGTCGAAGCCCGCGCGAG
AAAATCCAGCAGATCAGAAAGTCGCTCCATCTCGACGGCGAAGAAGAGAAGAGGCTGGCCAGGGAAAAGTACCAA
GCCATCGTTGCAAAGAAGGGGCGTCGCAACTGGACTTCCTGGGCCATGGAATTTGAGAGAGCCTTTTTGGACTGC
AAGGACGTCAATGTCGAGGGTTATAACGATGCAAAGGCCCGAAGGGACTTTATCAAGTGTCTCTGCGCCTCGTCG
GTGCCGTGGGTGGCTTCGTGCGGCGTCAGCTTTTCGGTCACGGACGAAATGACCAAGGAGGAAGACAGAGCGAGT
CTCGAGGAGTTTGTGAGGATCTTTCGGGTGACCGCCGACCGCCGGTTTCAGACCATGGAATCATAG
Transcript >Ophcf2|00536
ATGAGTCACGATGGGATAATCCAGTTGGAAGACAAACACAACTTCACCCATTGGTTCAAGCAAATCAGGGCTGTA
GCCAACGGTATCTGGCTTTATGTTGACCCAGAGACCACCCTCGATGTCAATGAACCCATCAAACCGGAAAAGACG
GCTACCGACATGGAATGGGAGTACTGGAAGATAACAGCGCAGGATTATAATGCTATCGAGGAGCGAAAGAAGGAG
TTGAACGACATCATCCTGAATACCATCAGCCCGCAGCTCTGCCGTGAAGCAGCCAGGTGTCGAAGCCCGCGCGAG
AAAATCCAGCAGATCAGAAAGTCGCTCCATCTCGACGGCGAAGAAGAGAAGAGGCTGGCCAGGGAAAAGTACCAA
GCCATCGTTGCAAAGAAGGGGCGTCGCAACTGGACTTCCTGGGCCATGGAATTTGAGAGAGCCTTTTTGGACTGC
AAGGACGTCAATGTCGAGGGTTATAACGATGCAAAGGCCCGAAGGGACTTTATCAAGTGTCTCTGCGCCTCGTCG
GTGCCGTGGGTGGCTTCGTGCGGCGTCAGCTTTTCGGTCACGGACGAAATGACCAAGGAGGAAGACAGAGCGAGT
CTCGAGGAGTTTGTGAGGATCTTTCGGGTGACCGCCGACCGCCGGTTTCAGACCATGGAATCATAG
Gene >Ophcf2|00536
ATGAGTCACGATGGGATAATCCAGTTGGAAGACAAACACAACTTCACCCATTGGTTCAAGCAAATCAGGGCTGTA
GCCAACGGTATCTGGCTTTATGTTGACCCAGAGACCACCCTCGATGTCAATGAACCCATCAAACCGGAAAAGACG
GCTACCGACATGGAATGGGAGTACTGGAAGATAACAGCGCAGGATTATAATGCTATCGAGGAGCGAAAGAAGGAG
TTGAACGACATCATCCTGAATACCATCAGCCCGCAGCTCTGCCGTGAAGCAGCCAGGTGTCGAAGCCCGCGCGAG
AAAATCCAGCAGATCAGAAAGTCGCTCCATCTCGACGGCGAAGAAGAGAAGAGGCTGGCCAGGGAAAAGTACCAA
GCCATCGTTGCAAAGAAGGGGCGTCGCAACTGGACTTCCTGGGCCATGGAATTTGAGAGAGCCTTTTTGGACTGC
AAGGACGTCAATGTCGAGGGTTATAACGATGCAAAGGCCCGAAGGGACTTTATCAAGTGTCTCTGCGCCTCGTCG
GTGCCGTGGGTGGCTTCGTGCGGCGTCAGCTTTTCGGTCACGGACGAAATGACCAAGGAGGAAGACAGAGCGAGT
CTCGAGGAGTTTGTGAGGATCTTTCGGGTGACCGCCGACCGCCGGTTTCAGACCATGGAATCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail