Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00535
Gene name
Locationscaffold_01:2169776..2170562
Strand-
Gene length (bp)786
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 8.3E-10 26 69
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 5.9E-08 27 68
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 7.6E-07 24 75

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5583 0.7842 0.052 0.0103 0.1947 0.0063 0.2968 0.3166 0.1518 0.0046

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|861
Ophiocordyceps australis map64 (Brazil) OphauB2|7608
Ophiocordyceps camponoti-floridani Ophcf2|00535 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00536
Ophiocordyceps camponoti-rufipedis Ophun1|3389
Ophiocordyceps kimflemingae Ophio5|7640
Ophiocordyceps subramaniannii Hirsu2|789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00535
MRPRIPARAARHPLAHSIEASPTETQCVICLDAISEICELQPCRHRTFHFPCIDHWLRSDTRRSCPVCKTAVSRV
AYGPVGDLQSYEYGAGEGEGEGGRRLRRRRRVEEPAGLAFRRHVYRRMRYSMHVGSNLRSGYRELCPRVFLSDVR
LQCRARAFLRRELRVFGWLVTPEDEDAAAATAAPGEGPSSSRAVTVDRLVGHIVRLLCRFEIRGCDGVLRDHVAR
HLGQRNTSLLLHELHSFLRSPFESPQSWDLHVQYGR*
Coding >Ophcf2|00535
ATGCGCCCCCGAATCCCAGCCCGCGCCGCCCGTCATCCCCTCGCGCACAGCATCGAAGCCTCACCAACAGAAACA
CAATGTGTCATATGCCTTGATGCAATCAGCGAGATCTGTGAACTCCAGCCTTGCCGACACCGTACCTTCCACTTC
CCCTGCATCGACCACTGGCTACGCTCCGACACGCGACGATCTTGCCCCGTCTGCAAGACTGCTGTCTCGCGCGTG
GCGTACGGACCGGTGGGGGATCTGCAAAGCTACGAGTATGGTGCTGGCGAGGGCGAGGGCGAGGGCGGACGGCGG
CTTCGGAGACGGAGGAGGGTGGAAGAGCCGGCTGGTCTTGCTTTTCGCCGCCACGTTTACCGTCGGATGCGGTAC
TCGATGCACGTCGGGTCCAATCTGCGTTCCGGATACCGCGAGCTTTGTCCGCGGGTGTTCCTCTCTGACGTGCGC
TTACAGTGTCGGGCGAGGGCCTTTCTGCGCCGTGAGCTGCGCGTCTTTGGCTGGCTTGTCACTCCCGAGGACGAA
GATGCTGCTGCTGCTACTGCTGCTCCGGGGGAGGGGCCATCTTCTAGTCGGGCTGTGACGGTCGATCGGCTGGTT
GGACATATCGTTCGCTTGCTGTGTCGATTTGAGATCCGTGGGTGTGATGGCGTGTTGAGGGATCATGTTGCGAGG
CACTTGGGACAGCGAAACACGAGTCTTTTGCTGCATGAGTTGCATTCTTTTCTGAGGAGTCCGTTTGAGAGTCCG
CAGAGCTGGGACTTGCATGTTCAGTATGGGCGATGA
Transcript >Ophcf2|00535
ATGCGCCCCCGAATCCCAGCCCGCGCCGCCCGTCATCCCCTCGCGCACAGCATCGAAGCCTCACCAACAGAAACA
CAATGTGTCATATGCCTTGATGCAATCAGCGAGATCTGTGAACTCCAGCCTTGCCGACACCGTACCTTCCACTTC
CCCTGCATCGACCACTGGCTACGCTCCGACACGCGACGATCTTGCCCCGTCTGCAAGACTGCTGTCTCGCGCGTG
GCGTACGGACCGGTGGGGGATCTGCAAAGCTACGAGTATGGTGCTGGCGAGGGCGAGGGCGAGGGCGGACGGCGG
CTTCGGAGACGGAGGAGGGTGGAAGAGCCGGCTGGTCTTGCTTTTCGCCGCCACGTTTACCGTCGGATGCGGTAC
TCGATGCACGTCGGGTCCAATCTGCGTTCCGGATACCGCGAGCTTTGTCCGCGGGTGTTCCTCTCTGACGTGCGC
TTACAGTGTCGGGCGAGGGCCTTTCTGCGCCGTGAGCTGCGCGTCTTTGGCTGGCTTGTCACTCCCGAGGACGAA
GATGCTGCTGCTGCTACTGCTGCTCCGGGGGAGGGGCCATCTTCTAGTCGGGCTGTGACGGTCGATCGGCTGGTT
GGACATATCGTTCGCTTGCTGTGTCGATTTGAGATCCGTGGGTGTGATGGCGTGTTGAGGGATCATGTTGCGAGG
CACTTGGGACAGCGAAACACGAGTCTTTTGCTGCATGAGTTGCATTCTTTTCTGAGGAGTCCGTTTGAGAGTCCG
CAGAGCTGGGACTTGCATGTTCAGTATGGGCGATGA
Gene >Ophcf2|00535
ATGCGCCCCCGAATCCCAGCCCGCGCCGCCCGTCATCCCCTCGCGCACAGCATCGAAGCCTCACCAACAGAAACA
CAATGTGTCATATGCCTTGATGCAATCAGCGAGATCTGTGAACTCCAGCCTTGCCGACACCGTACCTTCCACTTC
CCCTGCATCGACCACTGGCTACGCTCCGACACGCGACGATCTTGCCCCGTCTGCAAGACTGCTGTCTCGCGCGTG
GCGTACGGACCGGTGGGGGATCTGCAAAGCTACGAGTATGGTGCTGGCGAGGGCGAGGGCGAGGGCGGACGGCGG
CTTCGGAGACGGAGGAGGGTGGAAGAGCCGGCTGGTCTTGCTTTTCGCCGCCACGTTTACCGTCGGATGCGGTAC
TCGATGCACGTCGGGTCCAATCTGCGTTCCGGATACCGCGAGCTTTGTCCGCGGGTGTTCCTCTCTGACGTGCGC
TTACAGTGTCGGGCGAGGGCCTTTCTGCGCCGTGAGCTGCGCGTCTTTGGCTGGCTTGTCACTCCCGAGGACGAA
GATGCTGCTGCTGCTACTGCTGCTCCGGGGGAGGGGCCATCTTCTAGTCGGGCTGTGACGGTCGATCGGCTGGTT
GGACATATCGTTCGCTTGCTGTGTCGATTTGAGATCCGTGGGTGTGATGGCGTGTTGAGGGATCATGTTGCGAGG
CACTTGGGACAGCGAAACACGAGTCTTTTGCTGCATGAGTTGCATTCTTTTCTGAGGAGTCCGTTTGAGAGTCCG
CAGAGCTGGGACTTGCATGTTCAGTATGGGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail