Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00533
Gene name
Locationscaffold_01:2164656..2166172
Strand-
Gene length (bp)1516
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-14 16 91

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4735 0.1902 0.1011 0.0573 0.3547 0.0342 0.4357 0.2014 0.1641 0.0132

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 11 30 19
2 151 173 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1840
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5076
Ophiocordyceps australis map64 (Brazil) OphauB2|2088
Ophiocordyceps camponoti-floridani Ophcf2|00533 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3391
Ophiocordyceps kimflemingae Ophio5|6988
Ophiocordyceps subramaniannii Hirsu2|1841

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00533
MAESSEGDDDNITVAVIGTGLAGLTAAHLLQNDHQHRYRVTLFDKAKNLSLDSASVTVRHAETARVERVDLPMRA
CAGGYYENLLRMCRHLAIPLHPVRFLFAFAAMLPTGHSWRCEATGPGDVGSAPGTYFVYASNMHRALPPRPAGRR
LVSYWVEVLYLVVCQAWFIAVCFLVRPKTRPVAETLGQYLDRTRVPRRFSRQYLLPLMSSVSTCSHAEMLAFPAS
DVVDYKRLSHGRQHYAVCGGVWRVQSRLAEGVRNVRLGCQVTSVEVDRGRLLVHWHSTAEDGSPSAKDEVFDRVI
LAVSPDMAAAVFRPLSDVLGKMPTKRVESSVLNRWPGTITVVADDGASTAPCSFRHGDGCDAQPPHVVTLRTRFA
GTASATEAFHALPSGVLVHTCPLDSTTEPAETVLRKASFTRTLRTAESKAVVESIFGRVPERGWKNGQDNVWLVG
SWCWDGMVLLEGCVVSALRVARDFDVGVSWGDAGALQR*
Coding >Ophcf2|00533
ATGGCCGAGTCCAGCGAGGGAGATGACGACAACATCACCGTCGCCGTCATCGGCACCGGCCTCGCAGGCTTGACG
GCTGCCCATCTGCTGCAAAACGACCATCAGCACCGTTACCGCGTCACTCTCTTCGACAAGGCCAAAAACCTCTCG
CTCGACTCGGCGTCAGTGACCGTCAGACATGCCGAGACGGCTCGCGTCGAACGCGTCGACCTGCCCATGCGGGCC
TGCGCCGGCGGATACTATGAGAACCTGCTGCGCATGTGTCGTCATCTCGCCATTCCGCTCCATCCCGTCCGTTTC
CTCTTCGCCTTTGCCGCCATGCTGCCGACGGGACACTCGTGGCGGTGCGAGGCGACGGGGCCCGGCGACGTCGGC
TCCGCCCCGGGAACCTACTTCGTCTACGCCTCCAACATGCACCGCGCCCTGCCGCCGAGACCCGCGGGCCGCCGT
CTGGTGTCGTACTGGGTCGAGGTGCTGTACCTCGTCGTCTGTCAGGCCTGGTTCATCGCCGTCTGCTTCCTGGTG
CGGCCCAAGACGAGGCCCGTAGCGGAGACGTTGGGTCAGTACCTCGACAGGACGCGGGTGCCTCGCCGGTTCTCG
AGGCAATACCTGCTCCCTCTGATGAGCAGCGTCTCGACATGCTCGCACGCCGAGATGCTCGCCTTCCCCGCGAGT
GATGTCGTTGACTACAAGAGGCTGTCGCACGGCCGGCAGCACTACGCTGTCTGCGGTGGCGTGTGGCGTGTACAA
TCGCGGCTCGCCGAGGGTGTTCGCAATGTCCGGCTCGGCTGCCAGGTAACGAGCGTCGAGGTCGACCGCGGCCGC
CTGCTGGTGCATTGGCATTCGACGGCCGAAGACGGGTCGCCCTCGGCTAAGGATGAGGTCTTTGACCGCGTCATC
CTGGCCGTATCCCCGGACATGGCGGCGGCCGTGTTCCGCCCATTGTCCGACGTTCTGGGAAAGATGCCGACGAAG
CGGGTCGAGAGCTCGGTGCTTAACCGGTGGCCGGGGACCATCACCGTCGTGGCCGATGACGGGGCCTCTACCGCG
CCGTGCTCGTTTCGTCACGGAGATGGATGCGACGCCCAGCCACCTCATGTGGTGACGCTCCGGACGCGCTTCGCC
GGGACCGCGTCGGCGACTGAAGCGTTCCACGCCCTGCCGAGCGGCGTGCTGGTCCACACGTGTCCGCTAGATTCG
ACGACGGAACCGGCCGAGACGGTGCTGCGCAAGGCCAGTTTCACGAGGACGCTGCGGACGGCCGAAAGCAAGGCC
GTGGTCGAGAGCATCTTCGGACGGGTGCCGGAGCGCGGTTGGAAGAATGGACAAGACAATGTCTGGCTGGTCGGC
TCTTGGTGTTGGGACGGTATGGTCCTTCTTGAGGGCTGCGTCGTCTCTGCTTTGCGCGTCGCTCGAGACTTTGAC
GTTGGAGTGTCGTGGGGAGATGCGGGGGCGCTTCAACGTTGA
Transcript >Ophcf2|00533
ATGGCCGAGTCCAGCGAGGGAGATGACGACAACATCACCGTCGCCGTCATCGGCACCGGCCTCGCAGGCTTGACG
GCTGCCCATCTGCTGCAAAACGACCATCAGCACCGTTACCGCGTCACTCTCTTCGACAAGGCCAAAAACCTCTCG
CTCGACTCGGCGTCAGTGACCGTCAGACATGCCGAGACGGCTCGCGTCGAACGCGTCGACCTGCCCATGCGGGCC
TGCGCCGGCGGATACTATGAGAACCTGCTGCGCATGTGTCGTCATCTCGCCATTCCGCTCCATCCCGTCCGTTTC
CTCTTCGCCTTTGCCGCCATGCTGCCGACGGGACACTCGTGGCGGTGCGAGGCGACGGGGCCCGGCGACGTCGGC
TCCGCCCCGGGAACCTACTTCGTCTACGCCTCCAACATGCACCGCGCCCTGCCGCCGAGACCCGCGGGCCGCCGT
CTGGTGTCGTACTGGGTCGAGGTGCTGTACCTCGTCGTCTGTCAGGCCTGGTTCATCGCCGTCTGCTTCCTGGTG
CGGCCCAAGACGAGGCCCGTAGCGGAGACGTTGGGTCAGTACCTCGACAGGACGCGGGTGCCTCGCCGGTTCTCG
AGGCAATACCTGCTCCCTCTGATGAGCAGCGTCTCGACATGCTCGCACGCCGAGATGCTCGCCTTCCCCGCGAGT
GATGTCGTTGACTACAAGAGGCTGTCGCACGGCCGGCAGCACTACGCTGTCTGCGGTGGCGTGTGGCGTGTACAA
TCGCGGCTCGCCGAGGGTGTTCGCAATGTCCGGCTCGGCTGCCAGGTAACGAGCGTCGAGGTCGACCGCGGCCGC
CTGCTGGTGCATTGGCATTCGACGGCCGAAGACGGGTCGCCCTCGGCTAAGGATGAGGTCTTTGACCGCGTCATC
CTGGCCGTATCCCCGGACATGGCGGCGGCCGTGTTCCGCCCATTGTCCGACGTTCTGGGAAAGATGCCGACGAAG
CGGGTCGAGAGCTCGGTGCTTAACCGGTGGCCGGGGACCATCACCGTCGTGGCCGATGACGGGGCCTCTACCGCG
CCGTGCTCGTTTCGTCACGGAGATGGATGCGACGCCCAGCCACCTCATGTGGTGACGCTCCGGACGCGCTTCGCC
GGGACCGCGTCGGCGACTGAAGCGTTCCACGCCCTGCCGAGCGGCGTGCTGGTCCACACGTGTCCGCTAGATTCG
ACGACGGAACCGGCCGAGACGGTGCTGCGCAAGGCCAGTTTCACGAGGACGCTGCGGACGGCCGAAAGCAAGGCC
GTGGTCGAGAGCATCTTCGGACGGGTGCCGGAGCGCGGTTGGAAGAATGGACAAGACAATGTCTGGCTGGTCGGC
TCTTGGTGTTGGGACGGTATGGTCCTTCTTGAGGGCTGCGTCGTCTCTGCTTTGCGCGTCGCTCGAGACTTTGAC
GTTGGAGTGTCGTGGGGAGATGCGGGGGCGCTTCAACGTTGA
Gene >Ophcf2|00533
ATGGCCGAGTCCAGCGAGGGAGATGACGACAACATCACCGTCGCCGTCATCGGCACCGGCCTCGCAGGCTTGACG
GCTGCCCATCTGCTGCAAAACGACCATCAGCACCGTTACCGCGTCACTCTCTTCGACAAGGTGTGACCGGCGCCT
CTTCTTACCGCGGGCAAGCTGACCTCCCGCTGAGGCCAAAAACCTCTCGCTCGACTCGGCGTCAGTGACCGTCAG
ACATGCCGAGACGGCTCGCGTCGAACGCGTCGACCTGCCCATGCGGGCCTGCGCCGGCGGATACTATGAGAACCT
GCTGCGCATGTGTCGTCATCTCGCCATTCCGCTCCATCCCGTCCGTTTCCTCTTCGCCTTTGCCGCCATGCTGCC
GACGGGACACTCGTGGCGGTGCGAGGCGACGGGGCCCGGCGACGTCGGCTCCGCCCCGGGAACCTACTTCGTCTA
CGCCTCCAACATGCACCGCGCCCTGCCGCCGAGACCCGCGGGCCGCCGTCTGGTGTCGTACTGGGTCGAGGTGCT
GTACCTCGTCGTCTGTCAGGCCTGGTTCATCGCCGTCTGCTTCCTGGTGCGGCCCAAGACGAGGCCCGTAGCGGA
GACGTTGGGTCAGTACCTCGACAGGACGCGGGTGCCTCGCCGGTTCTCGAGGCAATACCTGCTCCCTCTGATGAG
CAGCGTCTCGACATGCTCGCACGCCGAGATGCTCGCCTTCCCCGCGAGTGATGTCGTTGACTACAAGAGGCTGTC
GCACGGCCGGCAGCACTACGCTGTCTGCGGTGGCGTGTGGCGTGTACAATCGCGGCTCGCCGAGGGTGTTCGCAA
TGTCCGGCTCGGCTGCCAGGTAACGAGCGTCGAGGTCGACCGCGGCCGCCTGCTGGTGCATTGGCATTCGACGGC
CGAAGACGGGTCGCCCTCGGCTAAGGATGAGGTCTTTGACCGCGTCATCCTGGCCGTATCCCCGGACATGGCGGC
GGCCGTGTTCCGCCCATTGTCCGACGTTCTGGGAAAGATGCCGACGAAGCGGGTCGAGAGCTCGGTGCTTAACCG
GTGGCCGGGGACCATCACCGTCGTGGCCGATGACGGGGCCTCTACCGCGCCGTGCTCGTTTCGTCACGGAGATGG
ATGCGACGCCCAGCCACCTCATGTGGTGACGCTCCGGACGCGCTTCGCCGGGACCGCGTCGGCGACTGAAGCGTT
CCACGCCCTGCCGAGCGGCGTGCTGGTCCACACGTGTCCGCTAGATTCGACGACGGAACCGGCCGAGACGGTGCT
GCGCAAGGCCAGTTTCACGAGGACGCTGCGGACGGCCGAAAGCAAGGCCGTGGTCGAGAGCATCTTCGGACGGGT
GCCGGAGCGCGGTTGGAAGAATGGACAAGACAATGTCTGGCTGGTCGGCTCTTGGTGTTGGGACGGTATGGTCCT
TCTTGAGGGCTGCGTCGTCTCTGCTTTGCGCGTCGCTCGAGACTTTGACGTTGGAGTGTCGTGGGGAGATGCGGG
GGCGCTTCAACGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail