Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00533
Gene name
Locationscaffold_01:2164656..2166172
Strand-
Gene length (bp)1516
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-14 16 91

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 11 30 19
2 151 173 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00533
MAESSEGDDDNITVAVIGTGLAGLTAAHLLQNDHQHRYRVTLFDKAKNLSLDSASVTVRHAETARVERVDLPMRA
CAGGYYENLLRMCRHLAIPLHPVRFLFAFAAMLPTGHSWRCEATGPGDVGSAPGTYFVYASNMHRALPPRPAGRR
LVSYWVEVLYLVVCQAWFIAVCFLVRPKTRPVAETLGQYLDRTRVPRRFSRQYLLPLMSSVSTCSHAEMLAFPAS
DVVDYKRLSHGRQHYAVCGGVWRVQSRLAEGVRNVRLGCQVTSVEVDRGRLLVHWHSTAEDGSPSAKDEVFDRVI
LAVSPDMAAAVFRPLSDVLGKMPTKRVESSVLNRWPGTITVVADDGASTAPCSFRHGDGCDAQPPHVVTLRTRFA
GTASATEAFHALPSGVLVHTCPLDSTTEPAETVLRKASFTRTLRTAESKAVVESIFGRVPERGWKNGQDNVWLVG
SWCWDGMVLLEGCVVSALRVARDFDVGVSWGDAGALQR*
Coding >Ophcf2|00533
ATGGCCGAGTCCAGCGAGGGAGATGACGACAACATCACCGTCGCCGTCATCGGCACCGGCCTCGCAGGCTTGACG
GCTGCCCATCTGCTGCAAAACGACCATCAGCACCGTTACCGCGTCACTCTCTTCGACAAGGCCAAAAACCTCTCG
CTCGACTCGGCGTCAGTGACCGTCAGACATGCCGAGACGGCTCGCGTCGAACGCGTCGACCTGCCCATGCGGGCC
TGCGCCGGCGGATACTATGAGAACCTGCTGCGCATGTGTCGTCATCTCGCCATTCCGCTCCATCCCGTCCGTTTC
CTCTTCGCCTTTGCCGCCATGCTGCCGACGGGACACTCGTGGCGGTGCGAGGCGACGGGGCCCGGCGACGTCGGC
TCCGCCCCGGGAACCTACTTCGTCTACGCCTCCAACATGCACCGCGCCCTGCCGCCGAGACCCGCGGGCCGCCGT
CTGGTGTCGTACTGGGTCGAGGTGCTGTACCTCGTCGTCTGTCAGGCCTGGTTCATCGCCGTCTGCTTCCTGGTG
CGGCCCAAGACGAGGCCCGTAGCGGAGACGTTGGGTCAGTACCTCGACAGGACGCGGGTGCCTCGCCGGTTCTCG
AGGCAATACCTGCTCCCTCTGATGAGCAGCGTCTCGACATGCTCGCACGCCGAGATGCTCGCCTTCCCCGCGAGT
GATGTCGTTGACTACAAGAGGCTGTCGCACGGCCGGCAGCACTACGCTGTCTGCGGTGGCGTGTGGCGTGTACAA
TCGCGGCTCGCCGAGGGTGTTCGCAATGTCCGGCTCGGCTGCCAGGTAACGAGCGTCGAGGTCGACCGCGGCCGC
CTGCTGGTGCATTGGCATTCGACGGCCGAAGACGGGTCGCCCTCGGCTAAGGATGAGGTCTTTGACCGCGTCATC
CTGGCCGTATCCCCGGACATGGCGGCGGCCGTGTTCCGCCCATTGTCCGACGTTCTGGGAAAGATGCCGACGAAG
CGGGTCGAGAGCTCGGTGCTTAACCGGTGGCCGGGGACCATCACCGTCGTGGCCGATGACGGGGCCTCTACCGCG
CCGTGCTCGTTTCGTCACGGAGATGGATGCGACGCCCAGCCACCTCATGTGGTGACGCTCCGGACGCGCTTCGCC
GGGACCGCGTCGGCGACTGAAGCGTTCCACGCCCTGCCGAGCGGCGTGCTGGTCCACACGTGTCCGCTAGATTCG
ACGACGGAACCGGCCGAGACGGTGCTGCGCAAGGCCAGTTTCACGAGGACGCTGCGGACGGCCGAAAGCAAGGCC
GTGGTCGAGAGCATCTTCGGACGGGTGCCGGAGCGCGGTTGGAAGAATGGACAAGACAATGTCTGGCTGGTCGGC
TCTTGGTGTTGGGACGGTATGGTCCTTCTTGAGGGCTGCGTCGTCTCTGCTTTGCGCGTCGCTCGAGACTTTGAC
GTTGGAGTGTCGTGGGGAGATGCGGGGGCGCTTCAACGTTGA
Transcript >Ophcf2|00533
ATGGCCGAGTCCAGCGAGGGAGATGACGACAACATCACCGTCGCCGTCATCGGCACCGGCCTCGCAGGCTTGACG
GCTGCCCATCTGCTGCAAAACGACCATCAGCACCGTTACCGCGTCACTCTCTTCGACAAGGCCAAAAACCTCTCG
CTCGACTCGGCGTCAGTGACCGTCAGACATGCCGAGACGGCTCGCGTCGAACGCGTCGACCTGCCCATGCGGGCC
TGCGCCGGCGGATACTATGAGAACCTGCTGCGCATGTGTCGTCATCTCGCCATTCCGCTCCATCCCGTCCGTTTC
CTCTTCGCCTTTGCCGCCATGCTGCCGACGGGACACTCGTGGCGGTGCGAGGCGACGGGGCCCGGCGACGTCGGC
TCCGCCCCGGGAACCTACTTCGTCTACGCCTCCAACATGCACCGCGCCCTGCCGCCGAGACCCGCGGGCCGCCGT
CTGGTGTCGTACTGGGTCGAGGTGCTGTACCTCGTCGTCTGTCAGGCCTGGTTCATCGCCGTCTGCTTCCTGGTG
CGGCCCAAGACGAGGCCCGTAGCGGAGACGTTGGGTCAGTACCTCGACAGGACGCGGGTGCCTCGCCGGTTCTCG
AGGCAATACCTGCTCCCTCTGATGAGCAGCGTCTCGACATGCTCGCACGCCGAGATGCTCGCCTTCCCCGCGAGT
GATGTCGTTGACTACAAGAGGCTGTCGCACGGCCGGCAGCACTACGCTGTCTGCGGTGGCGTGTGGCGTGTACAA
TCGCGGCTCGCCGAGGGTGTTCGCAATGTCCGGCTCGGCTGCCAGGTAACGAGCGTCGAGGTCGACCGCGGCCGC
CTGCTGGTGCATTGGCATTCGACGGCCGAAGACGGGTCGCCCTCGGCTAAGGATGAGGTCTTTGACCGCGTCATC
CTGGCCGTATCCCCGGACATGGCGGCGGCCGTGTTCCGCCCATTGTCCGACGTTCTGGGAAAGATGCCGACGAAG
CGGGTCGAGAGCTCGGTGCTTAACCGGTGGCCGGGGACCATCACCGTCGTGGCCGATGACGGGGCCTCTACCGCG
CCGTGCTCGTTTCGTCACGGAGATGGATGCGACGCCCAGCCACCTCATGTGGTGACGCTCCGGACGCGCTTCGCC
GGGACCGCGTCGGCGACTGAAGCGTTCCACGCCCTGCCGAGCGGCGTGCTGGTCCACACGTGTCCGCTAGATTCG
ACGACGGAACCGGCCGAGACGGTGCTGCGCAAGGCCAGTTTCACGAGGACGCTGCGGACGGCCGAAAGCAAGGCC
GTGGTCGAGAGCATCTTCGGACGGGTGCCGGAGCGCGGTTGGAAGAATGGACAAGACAATGTCTGGCTGGTCGGC
TCTTGGTGTTGGGACGGTATGGTCCTTCTTGAGGGCTGCGTCGTCTCTGCTTTGCGCGTCGCTCGAGACTTTGAC
GTTGGAGTGTCGTGGGGAGATGCGGGGGCGCTTCAACGTTGA
Gene >Ophcf2|00533
ATGGCCGAGTCCAGCGAGGGAGATGACGACAACATCACCGTCGCCGTCATCGGCACCGGCCTCGCAGGCTTGACG
GCTGCCCATCTGCTGCAAAACGACCATCAGCACCGTTACCGCGTCACTCTCTTCGACAAGGTGTGACCGGCGCCT
CTTCTTACCGCGGGCAAGCTGACCTCCCGCTGAGGCCAAAAACCTCTCGCTCGACTCGGCGTCAGTGACCGTCAG
ACATGCCGAGACGGCTCGCGTCGAACGCGTCGACCTGCCCATGCGGGCCTGCGCCGGCGGATACTATGAGAACCT
GCTGCGCATGTGTCGTCATCTCGCCATTCCGCTCCATCCCGTCCGTTTCCTCTTCGCCTTTGCCGCCATGCTGCC
GACGGGACACTCGTGGCGGTGCGAGGCGACGGGGCCCGGCGACGTCGGCTCCGCCCCGGGAACCTACTTCGTCTA
CGCCTCCAACATGCACCGCGCCCTGCCGCCGAGACCCGCGGGCCGCCGTCTGGTGTCGTACTGGGTCGAGGTGCT
GTACCTCGTCGTCTGTCAGGCCTGGTTCATCGCCGTCTGCTTCCTGGTGCGGCCCAAGACGAGGCCCGTAGCGGA
GACGTTGGGTCAGTACCTCGACAGGACGCGGGTGCCTCGCCGGTTCTCGAGGCAATACCTGCTCCCTCTGATGAG
CAGCGTCTCGACATGCTCGCACGCCGAGATGCTCGCCTTCCCCGCGAGTGATGTCGTTGACTACAAGAGGCTGTC
GCACGGCCGGCAGCACTACGCTGTCTGCGGTGGCGTGTGGCGTGTACAATCGCGGCTCGCCGAGGGTGTTCGCAA
TGTCCGGCTCGGCTGCCAGGTAACGAGCGTCGAGGTCGACCGCGGCCGCCTGCTGGTGCATTGGCATTCGACGGC
CGAAGACGGGTCGCCCTCGGCTAAGGATGAGGTCTTTGACCGCGTCATCCTGGCCGTATCCCCGGACATGGCGGC
GGCCGTGTTCCGCCCATTGTCCGACGTTCTGGGAAAGATGCCGACGAAGCGGGTCGAGAGCTCGGTGCTTAACCG
GTGGCCGGGGACCATCACCGTCGTGGCCGATGACGGGGCCTCTACCGCGCCGTGCTCGTTTCGTCACGGAGATGG
ATGCGACGCCCAGCCACCTCATGTGGTGACGCTCCGGACGCGCTTCGCCGGGACCGCGTCGGCGACTGAAGCGTT
CCACGCCCTGCCGAGCGGCGTGCTGGTCCACACGTGTCCGCTAGATTCGACGACGGAACCGGCCGAGACGGTGCT
GCGCAAGGCCAGTTTCACGAGGACGCTGCGGACGGCCGAAAGCAAGGCCGTGGTCGAGAGCATCTTCGGACGGGT
GCCGGAGCGCGGTTGGAAGAATGGACAAGACAATGTCTGGCTGGTCGGCTCTTGGTGTTGGGACGGTATGGTCCT
TCTTGAGGGCTGCGTCGTCTCTGCTTTGCGCGTCGCTCGAGACTTTGACGTTGGAGTGTCGTGGGGAGATGCGGG
GGCGCTTCAACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail