Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00527
Gene name
Locationscaffold_01:2153172..2153949
Strand-
Gene length (bp)777
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 1.9E-18 123 248

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 76 98 22
3 186 208 22
4 228 247 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.07 0.0 2.27
Alive In ants, during behavior modification 0.27 0.0 0.74
Dead In ants, recently dead 0.20 0.0 0.59

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.070836 no
Alive Dead 1.000000 no
Dead Fungus 0.052835 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00527
MGTKLSSLESFWLYLLANYDPFTIKFYGLLSVDVLAWWVPCFVFVSLEYLAPSFAARHKMQASEKSPTLRKLCRC
IIVALANTFLAAVEFTAFNHLFSTKAYPEGNRFDARLPSLSRFVGEFLMSFALREILFYWGHRALHWRPLYRSIH
RIHHEFSAPVAFASKYAHPIEFLTSDSLPIMLPPFILRTHVVSTFAFTAGTLFTSTIIHSGYDFFYRAAWMHDRH
HEGANAYFGAFGALGLIDWAHGTIEKDRKVKGL*
Coding >Ophcf2|00527
ATGGGCACCAAACTGTCGTCGCTGGAGAGCTTCTGGCTGTATCTCTTGGCCAACTATGACCCCTTCACTATCAAG
TTTTACGGCCTCCTCTCGGTCGACGTCTTGGCTTGGTGGGTTCCCTGCTTCGTCTTCGTCTCGCTCGAGTACCTG
GCGCCATCATTCGCGGCGAGACACAAGATGCAAGCATCGGAGAAGAGCCCTACGTTGAGAAAGTTGTGCCGCTGC
ATCATCGTCGCTCTCGCCAACACGTTTCTCGCGGCGGTCGAATTTACTGCCTTTAACCATCTGTTTTCCACAAAG
GCTTATCCCGAGGGCAACCGGTTCGATGCGAGGTTGCCGTCTTTGAGCCGCTTCGTGGGAGAGTTCCTCATGAGC
TTCGCCCTACGAGAGATCTTGTTCTACTGGGGACACCGGGCTCTTCACTGGCGGCCGTTATACAGAAGCATTCAC
AGGATACACCACGAGTTTTCCGCGCCCGTCGCCTTTGCGTCCAAGTACGCCCATCCTATCGAGTTTCTGACGTCG
GATTCGCTGCCCATCATGTTACCGCCTTTTATACTGCGGACGCACGTGGTTTCGACCTTTGCTTTTACGGCTGGT
ACGCTGTTCACGTCGACCATTATTCATAGCGGCTACGATTTCTTTTATAGGGCGGCATGGATGCATGATCGTCAT
CATGAGGGGGCGAATGCTTACTTTGGCGCCTTTGGTGCTCTGGGCCTGATCGATTGGGCTCATGGGACCATCGAG
AAGGATCGTAAGGTCAAGGGGCTGTGA
Transcript >Ophcf2|00527
ATGGGCACCAAACTGTCGTCGCTGGAGAGCTTCTGGCTGTATCTCTTGGCCAACTATGACCCCTTCACTATCAAG
TTTTACGGCCTCCTCTCGGTCGACGTCTTGGCTTGGTGGGTTCCCTGCTTCGTCTTCGTCTCGCTCGAGTACCTG
GCGCCATCATTCGCGGCGAGACACAAGATGCAAGCATCGGAGAAGAGCCCTACGTTGAGAAAGTTGTGCCGCTGC
ATCATCGTCGCTCTCGCCAACACGTTTCTCGCGGCGGTCGAATTTACTGCCTTTAACCATCTGTTTTCCACAAAG
GCTTATCCCGAGGGCAACCGGTTCGATGCGAGGTTGCCGTCTTTGAGCCGCTTCGTGGGAGAGTTCCTCATGAGC
TTCGCCCTACGAGAGATCTTGTTCTACTGGGGACACCGGGCTCTTCACTGGCGGCCGTTATACAGAAGCATTCAC
AGGATACACCACGAGTTTTCCGCGCCCGTCGCCTTTGCGTCCAAGTACGCCCATCCTATCGAGTTTCTGACGTCG
GATTCGCTGCCCATCATGTTACCGCCTTTTATACTGCGGACGCACGTGGTTTCGACCTTTGCTTTTACGGCTGGT
ACGCTGTTCACGTCGACCATTATTCATAGCGGCTACGATTTCTTTTATAGGGCGGCATGGATGCATGATCGTCAT
CATGAGGGGGCGAATGCTTACTTTGGCGCCTTTGGTGCTCTGGGCCTGATCGATTGGGCTCATGGGACCATCGAG
AAGGATCGTAAGGTCAAGGGGCTGTGA
Gene >Ophcf2|00527
ATGGGCACCAAACTGTCGTCGCTGGAGAGCTTCTGGCTGTATCTCTTGGCCAACTATGACCCCTTCACTATCAAG
TTTTACGGCCTCCTCTCGGTCGACGTCTTGGCTTGGTGGGTTCCCTGCTTCGTCTTCGTCTCGCTCGAGTACCTG
GCGCCATCATTCGCGGCGAGACACAAGATGCAAGCATCGGAGAAGAGCCCTACGTTGAGAAAGTTGTGCCGCTGC
ATCATCGTCGCTCTCGCCAACACGTTTCTCGCGGCGGTCGAATTTACTGCCTTTAACCATCTGTTTTCCACAAAG
GCTTATCCCGAGGGCAACCGGTTCGATGCGAGGTTGCCGTCTTTGAGCCGCTTCGTGGGAGAGTTCCTCATGAGC
TTCGCCCTACGAGAGATCTTGTTCTACTGGGGACACCGGGCTCTTCACTGGCGGCCGTTATACAGAAGCATTCAC
AGGATACACCACGAGTTTTCCGCGCCCGTCGCCTTTGCGTCCAAGTACGCCCATCCTATCGAGTTTCTGACGTCG
GATTCGCTGCCCATCATGTTACCGCCTTTTATACTGCGGACGCACGTGGTTTCGACCTTTGCTTTTACGGCTGGT
ACGCTGTTCACGTCGACCATTATTCATAGCGGCTACGATTTCTTTTATAGGGCGGCATGGATGCATGATCGTCAT
CATGAGGGGGCGAATGCTTACTTTGGCGCCTTTGGTGCTCTGGGCCTGATCGATTGGGCTCATGGGACCATCGAG
AAGGATCGTAAGGTCAAGGGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail