Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00527
Gene name
Locationscaffold_01:2153172..2153949
Strand-
Gene length (bp)777
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 1.9E-18 123 248

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 76 98 22
3 186 208 22
4 228 247 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00527
MGTKLSSLESFWLYLLANYDPFTIKFYGLLSVDVLAWWVPCFVFVSLEYLAPSFAARHKMQASEKSPTLRKLCRC
IIVALANTFLAAVEFTAFNHLFSTKAYPEGNRFDARLPSLSRFVGEFLMSFALREILFYWGHRALHWRPLYRSIH
RIHHEFSAPVAFASKYAHPIEFLTSDSLPIMLPPFILRTHVVSTFAFTAGTLFTSTIIHSGYDFFYRAAWMHDRH
HEGANAYFGAFGALGLIDWAHGTIEKDRKVKGL*
Coding >Ophcf2|00527
ATGGGCACCAAACTGTCGTCGCTGGAGAGCTTCTGGCTGTATCTCTTGGCCAACTATGACCCCTTCACTATCAAG
TTTTACGGCCTCCTCTCGGTCGACGTCTTGGCTTGGTGGGTTCCCTGCTTCGTCTTCGTCTCGCTCGAGTACCTG
GCGCCATCATTCGCGGCGAGACACAAGATGCAAGCATCGGAGAAGAGCCCTACGTTGAGAAAGTTGTGCCGCTGC
ATCATCGTCGCTCTCGCCAACACGTTTCTCGCGGCGGTCGAATTTACTGCCTTTAACCATCTGTTTTCCACAAAG
GCTTATCCCGAGGGCAACCGGTTCGATGCGAGGTTGCCGTCTTTGAGCCGCTTCGTGGGAGAGTTCCTCATGAGC
TTCGCCCTACGAGAGATCTTGTTCTACTGGGGACACCGGGCTCTTCACTGGCGGCCGTTATACAGAAGCATTCAC
AGGATACACCACGAGTTTTCCGCGCCCGTCGCCTTTGCGTCCAAGTACGCCCATCCTATCGAGTTTCTGACGTCG
GATTCGCTGCCCATCATGTTACCGCCTTTTATACTGCGGACGCACGTGGTTTCGACCTTTGCTTTTACGGCTGGT
ACGCTGTTCACGTCGACCATTATTCATAGCGGCTACGATTTCTTTTATAGGGCGGCATGGATGCATGATCGTCAT
CATGAGGGGGCGAATGCTTACTTTGGCGCCTTTGGTGCTCTGGGCCTGATCGATTGGGCTCATGGGACCATCGAG
AAGGATCGTAAGGTCAAGGGGCTGTGA
Transcript >Ophcf2|00527
ATGGGCACCAAACTGTCGTCGCTGGAGAGCTTCTGGCTGTATCTCTTGGCCAACTATGACCCCTTCACTATCAAG
TTTTACGGCCTCCTCTCGGTCGACGTCTTGGCTTGGTGGGTTCCCTGCTTCGTCTTCGTCTCGCTCGAGTACCTG
GCGCCATCATTCGCGGCGAGACACAAGATGCAAGCATCGGAGAAGAGCCCTACGTTGAGAAAGTTGTGCCGCTGC
ATCATCGTCGCTCTCGCCAACACGTTTCTCGCGGCGGTCGAATTTACTGCCTTTAACCATCTGTTTTCCACAAAG
GCTTATCCCGAGGGCAACCGGTTCGATGCGAGGTTGCCGTCTTTGAGCCGCTTCGTGGGAGAGTTCCTCATGAGC
TTCGCCCTACGAGAGATCTTGTTCTACTGGGGACACCGGGCTCTTCACTGGCGGCCGTTATACAGAAGCATTCAC
AGGATACACCACGAGTTTTCCGCGCCCGTCGCCTTTGCGTCCAAGTACGCCCATCCTATCGAGTTTCTGACGTCG
GATTCGCTGCCCATCATGTTACCGCCTTTTATACTGCGGACGCACGTGGTTTCGACCTTTGCTTTTACGGCTGGT
ACGCTGTTCACGTCGACCATTATTCATAGCGGCTACGATTTCTTTTATAGGGCGGCATGGATGCATGATCGTCAT
CATGAGGGGGCGAATGCTTACTTTGGCGCCTTTGGTGCTCTGGGCCTGATCGATTGGGCTCATGGGACCATCGAG
AAGGATCGTAAGGTCAAGGGGCTGTGA
Gene >Ophcf2|00527
ATGGGCACCAAACTGTCGTCGCTGGAGAGCTTCTGGCTGTATCTCTTGGCCAACTATGACCCCTTCACTATCAAG
TTTTACGGCCTCCTCTCGGTCGACGTCTTGGCTTGGTGGGTTCCCTGCTTCGTCTTCGTCTCGCTCGAGTACCTG
GCGCCATCATTCGCGGCGAGACACAAGATGCAAGCATCGGAGAAGAGCCCTACGTTGAGAAAGTTGTGCCGCTGC
ATCATCGTCGCTCTCGCCAACACGTTTCTCGCGGCGGTCGAATTTACTGCCTTTAACCATCTGTTTTCCACAAAG
GCTTATCCCGAGGGCAACCGGTTCGATGCGAGGTTGCCGTCTTTGAGCCGCTTCGTGGGAGAGTTCCTCATGAGC
TTCGCCCTACGAGAGATCTTGTTCTACTGGGGACACCGGGCTCTTCACTGGCGGCCGTTATACAGAAGCATTCAC
AGGATACACCACGAGTTTTCCGCGCCCGTCGCCTTTGCGTCCAAGTACGCCCATCCTATCGAGTTTCTGACGTCG
GATTCGCTGCCCATCATGTTACCGCCTTTTATACTGCGGACGCACGTGGTTTCGACCTTTGCTTTTACGGCTGGT
ACGCTGTTCACGTCGACCATTATTCATAGCGGCTACGATTTCTTTTATAGGGCGGCATGGATGCATGATCGTCAT
CATGAGGGGGCGAATGCTTACTTTGGCGCCTTTGGTGCTCTGGGCCTGATCGATTGGGCTCATGGGACCATCGAG
AAGGATCGTAAGGTCAAGGGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail