Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00524
Gene name
Locationscaffold_01:2147558..2149443
Strand-
Gene length (bp)1885
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00731 AIRC AIR carboxylase 2.9E-59 443 587
PF02222 ATP-grasp ATP-grasp domain 2.1E-48 127 302
PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain 1.9E-14 333 389
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 9.8E-06 126 292

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0006189 'de novo' IMP biosynthetic process Yes
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:0003824 catalytic activity No
GO:0018130 heterocycle biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0046040 IMP metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0016881 acid-amino acid ligase activity No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003674 molecular_function No
GO:0006188 IMP biosynthetic process No
GO:0016874 ligase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.655 0.3362 0.0145 0.0361 0.1598 0.0852 0.2303 0.1474 0.0447 0.2518

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4185
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4320
Ophiocordyceps australis map64 (Brazil) OphauB2|8060
Ophiocordyceps camponoti-floridani Ophcf2|00524 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3400
Ophiocordyceps kimflemingae Ophio5|8258
Ophiocordyceps subramaniannii Hirsu2|8502

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00524
MTSPPVIGLLGGGQLGRMLCEAAGPLGYNISVLDAADCPARQAAGGGRGHVVGSFKDAERVRELATRCHVLTVEI
EHVDVDVLEDIATNGVRGADGRVRRVPVHPCWRTLRLVQDKFSQKEHFRIKGIPVATQIALEAGHGLPASLQEAA
RSLGFPLVVKARKGSYDGRGNFKVAGPEDIEPAVRALGKLPLYAEKWVPFVAELAVMVIRTEDENGNCTGLHSYP
TVETVHEDDVCKTVLMPPRNVDAVVCESAQRLAKDVVRSLWGRGVFAVELFLLSDGSLTVNEVAPRPHNSGHYTI
EAVPYMSQFKAQLYAILDLVPPSIRLRPRVAQAAMVNILGGAAADSHHELVRLAETHYAEDRDVYLHLYGKAAKP
GRKIGHVTMTTPLAMDLQKALGPFVDAVDAIRQQRLASATAQLRPETTTSGTTQANKASSRNRDAPLVMVTMGSD
SDLTVLSAGLDILESFDVPYDCTITSAHRTPSRMTALAQSAASRGVEVLIAAAGGAAHLPGMLASETTLPVIGVP
VKATHLDGHDSLLSIVQMPRGVPVATVGINNSVNAALLAVRILGAHRAEYRERMERYMKGLKTEVEDKAAKLEEV
GYEAYLEEKKR*
Coding >Ophcf2|00524
ATGACCTCGCCACCCGTCATCGGCCTCCTCGGCGGCGGCCAGCTCGGCCGGATGCTCTGCGAGGCCGCCGGTCCT
CTAGGCTACAACATCTCCGTCCTCGACGCCGCCGACTGTCCGGCCCGGCAGGCGGCGGGCGGCGGGCGCGGGCAC
GTCGTCGGCTCTTTCAAAGACGCGGAGCGGGTGCGCGAACTGGCGACGCGCTGTCATGTTCTGACGGTCGAGATT
GAACATGTTGACGTCGACGTCCTCGAGGATATCGCCACTAATGGCGTGCGCGGTGCCGATGGTCGTGTGAGGAGG
GTGCCTGTTCATCCTTGTTGGCGGACGCTACGACTCGTGCAGGATAAGTTCAGTCAGAAGGAGCACTTTCGGATC
AAGGGCATTCCCGTCGCGACGCAGATTGCCCTCGAGGCTGGCCATGGTCTGCCCGCTTCACTCCAAGAGGCCGCC
CGCAGCCTAGGCTTTCCGCTGGTCGTCAAGGCTCGCAAGGGCTCGTACGACGGTCGCGGCAACTTCAAGGTCGCG
GGGCCCGAGGATATAGAGCCGGCTGTCCGGGCGCTGGGCAAGTTGCCGCTCTACGCTGAGAAATGGGTGCCATTT
GTGGCGGAGTTGGCTGTCATGGTGATTCGCACCGAGGACGAAAATGGGAATTGTACCGGCTTGCATTCGTATCCG
ACGGTCGAGACGGTTCATGAGGATGACGTTTGCAAGACGGTCTTGATGCCGCCGCGGAATGTCGATGCGGTTGTC
TGCGAATCTGCCCAGCGGCTCGCCAAGGACGTGGTGAGGAGTCTATGGGGACGAGGCGTCTTCGCCGTCGAGTTG
TTTCTATTATCGGATGGCTCCCTCACGGTCAACGAGGTGGCGCCGCGGCCGCACAACTCGGGTCACTACACCATC
GAGGCGGTGCCGTACATGTCGCAGTTCAAGGCCCAGCTTTACGCCATCCTCGACCTGGTGCCACCGTCGATACGG
CTTAGGCCTCGAGTCGCTCAGGCAGCCATGGTCAATATCCTGGGTGGTGCCGCTGCTGATTCGCACCATGAGCTG
GTCCGACTGGCCGAGACGCACTATGCCGAGGATCGCGATGTCTATCTTCACCTCTACGGCAAGGCGGCTAAGCCC
GGACGCAAGATTGGACATGTCACGATGACGACGCCGTTAGCCATGGACCTACAAAAGGCCTTAGGTCCTTTCGTA
GACGCCGTCGACGCCATTCGCCAGCAGCGGCTTGCATCAGCTACGGCTCAGCTTCGCCCCGAGACAACGACGAGT
GGTACTACTCAGGCTAACAAGGCGAGCTCACGCAACCGCGACGCCCCCCTAGTCATGGTGACGATGGGCTCCGAC
TCGGACCTTACGGTTCTCTCTGCCGGGCTCGACATACTCGAGAGCTTCGACGTGCCGTACGACTGCACCATCACG
TCGGCGCACCGCACGCCGTCGCGGATGACAGCCCTCGCGCAATCAGCAGCCTCGCGCGGTGTCGAGGTGCTCATC
GCGGCGGCCGGCGGCGCGGCTCATCTCCCGGGCATGCTGGCTTCGGAGACGACGCTTCCCGTCATTGGGGTGCCA
GTCAAGGCGACGCATCTCGACGGCCACGACTCGCTGCTCAGCATCGTGCAGATGCCTAGAGGCGTGCCGGTAGCG
ACGGTCGGCATCAACAACAGCGTCAATGCTGCGCTGCTGGCCGTCAGGATACTAGGTGCGCACAGGGCAGAGTAT
CGCGAGAGGATGGAGCGCTATATGAAGGGGTTGAAGACTGAGGTCGAGGACAAGGCGGCCAAACTAGAGGAGGTT
GGTTATGAGGCGTATCTAGAGGAGAAGAAGAGGTGA
Transcript >Ophcf2|00524
ATGACCTCGCCACCCGTCATCGGCCTCCTCGGCGGCGGCCAGCTCGGCCGGATGCTCTGCGAGGCCGCCGGTCCT
CTAGGCTACAACATCTCCGTCCTCGACGCCGCCGACTGTCCGGCCCGGCAGGCGGCGGGCGGCGGGCGCGGGCAC
GTCGTCGGCTCTTTCAAAGACGCGGAGCGGGTGCGCGAACTGGCGACGCGCTGTCATGTTCTGACGGTCGAGATT
GAACATGTTGACGTCGACGTCCTCGAGGATATCGCCACTAATGGCGTGCGCGGTGCCGATGGTCGTGTGAGGAGG
GTGCCTGTTCATCCTTGTTGGCGGACGCTACGACTCGTGCAGGATAAGTTCAGTCAGAAGGAGCACTTTCGGATC
AAGGGCATTCCCGTCGCGACGCAGATTGCCCTCGAGGCTGGCCATGGTCTGCCCGCTTCACTCCAAGAGGCCGCC
CGCAGCCTAGGCTTTCCGCTGGTCGTCAAGGCTCGCAAGGGCTCGTACGACGGTCGCGGCAACTTCAAGGTCGCG
GGGCCCGAGGATATAGAGCCGGCTGTCCGGGCGCTGGGCAAGTTGCCGCTCTACGCTGAGAAATGGGTGCCATTT
GTGGCGGAGTTGGCTGTCATGGTGATTCGCACCGAGGACGAAAATGGGAATTGTACCGGCTTGCATTCGTATCCG
ACGGTCGAGACGGTTCATGAGGATGACGTTTGCAAGACGGTCTTGATGCCGCCGCGGAATGTCGATGCGGTTGTC
TGCGAATCTGCCCAGCGGCTCGCCAAGGACGTGGTGAGGAGTCTATGGGGACGAGGCGTCTTCGCCGTCGAGTTG
TTTCTATTATCGGATGGCTCCCTCACGGTCAACGAGGTGGCGCCGCGGCCGCACAACTCGGGTCACTACACCATC
GAGGCGGTGCCGTACATGTCGCAGTTCAAGGCCCAGCTTTACGCCATCCTCGACCTGGTGCCACCGTCGATACGG
CTTAGGCCTCGAGTCGCTCAGGCAGCCATGGTCAATATCCTGGGTGGTGCCGCTGCTGATTCGCACCATGAGCTG
GTCCGACTGGCCGAGACGCACTATGCCGAGGATCGCGATGTCTATCTTCACCTCTACGGCAAGGCGGCTAAGCCC
GGACGCAAGATTGGACATGTCACGATGACGACGCCGTTAGCCATGGACCTACAAAAGGCCTTAGGTCCTTTCGTA
GACGCCGTCGACGCCATTCGCCAGCAGCGGCTTGCATCAGCTACGGCTCAGCTTCGCCCCGAGACAACGACGAGT
GGTACTACTCAGGCTAACAAGGCGAGCTCACGCAACCGCGACGCCCCCCTAGTCATGGTGACGATGGGCTCCGAC
TCGGACCTTACGGTTCTCTCTGCCGGGCTCGACATACTCGAGAGCTTCGACGTGCCGTACGACTGCACCATCACG
TCGGCGCACCGCACGCCGTCGCGGATGACAGCCCTCGCGCAATCAGCAGCCTCGCGCGGTGTCGAGGTGCTCATC
GCGGCGGCCGGCGGCGCGGCTCATCTCCCGGGCATGCTGGCTTCGGAGACGACGCTTCCCGTCATTGGGGTGCCA
GTCAAGGCGACGCATCTCGACGGCCACGACTCGCTGCTCAGCATCGTGCAGATGCCTAGAGGCGTGCCGGTAGCG
ACGGTCGGCATCAACAACAGCGTCAATGCTGCGCTGCTGGCCGTCAGGATACTAGGTGCGCACAGGGCAGAGTAT
CGCGAGAGGATGGAGCGCTATATGAAGGGGTTGAAGACTGAGGTCGAGGACAAGGCGGCCAAACTAGAGGAGGTT
GGTTATGAGGCGTATCTAGAGGAGAAGAAGAGGTGA
Gene >Ophcf2|00524
ATGACCTCGCCACCCGTCATCGGCCTCCTCGGCGGCGGCCAGCTCGGCCGGATGCTCTGCGAGGCCGCCGGTCCT
CTAGGCTACAACATCTCCGTCCTCGACGCCGCCGACTGTCCGGCCCGGCAGGCGGCGGGCGGCGGGCGCGGGCAC
GTCGTCGGCTCTTTCAAAGACGCGGAGCGGGTGCGCGAACTGGCGACGCGCTGTCATGTTCTGACGGTCGAGATT
GAACATGTTGACGTCGACGTCCTCGAGGATATCGCCACTAATGGCGTGCGCGGTGCCGATGGTCGTGTGAGGAGG
GTGCCTGTTCATCCTTGTTGGCGGACGCTACGACTCGTGCAGGATAAGTTCAGTCAGAAGGAGCACTTTCGGATC
AAGGGCATTCCCGTCGCGACGCAGATTGCCCTCGAGGCTGGCCATGGTCTGCCCGCTTCACTCCAAGAGGCCGCC
CGCAGCCTAGGCTTTCCGCTGGTCGTCAAGGCTCGCAAGGGCTCGTACGACGGTCGCGGCAACTTCAAGGTCGCG
GGGCCCGAGGATATAGAGCCGGCTGTCCGGGCGCTGGGCAAGTTGCCGCTCTACGCTGAGAAATGGGTGCCATTT
GTGGCGGAGTTGGCTGTCATGGTGATTCGCACCGAGGACGAAAATGGGAATTGTACCGGCTTGCATTCGTATCCG
ACGGTCGAGACGGTTCATGAGGATGACGTTTGCAAGACGGTCTTGATGCCGCCGCGGAATGTCGATGCGGTTGTC
TGCGAATCTGCCCAGCGGCTCGCCAAGGACGTGGTGAGGAGTCTATGGGGACGAGGCGTCTTCGCCGTCGAGTTG
TTTCTATTATCGGATGGTTCGTATGCCCTTTCCCCATCTCCTTCTTCCCGACTAATTCGAGACAGGCTCCCTCAC
GGTCAACGAGGTGGCGCCGCGGCCGCACAACTCGGGTCACTACACCATCGAGGCGGTGCCGTACATGTCGCAGTT
CAAGGCCCAGCTTTACGCCATCCTCGACCTGGTGCCACCGTCGATACGGCTTAGGCCTCGAGTCGCTCAGGCAGC
CATGGTCAATATCCTGGGTGGTGCCGCTGCTGATTCGCACCATGAGCTGGTCCGACTGGCCGAGACGCACTATGC
CGAGGATCGCGATGTCTATCTTCACCTCTACGGCAAGGCGGCTAAGCCCGGACGCAAGATTGGACATGTCACGAT
GACGACGCCGTTAGCCATGGACCTACAAAAGGCCTTAGGTCCTTTCGTAGACGCCGTCGACGCCATTCGCCAGCA
GCGGCTTGCATCAGCTACGGCTCAGCTTCGCCCCGAGACAACGACGAGTGGTACTACTCAGGCTAACAAGGCGAG
CTCACGCAACCGCGACGCCCCCCTAGTCATGGTGACGATGGGCTCCGACTCGGACCTTACGGTTCTCTCTGCCGG
GCTCGACATACTCGAGAGCTTCGACGTGCCGTACGACTGCACCATCACGTCGGCGCACCGCACGCCGTCGCGGAT
GACAGCCCTCGCGCAATCAGCAGCCTCGCGCGGTGTCGAGGTGCTCATCGCGGCGGCCGGCGGCGCGGCTCATCT
CCCGGGCATGCTGGCTTCGGAGACGACGCTTCCCGTCATTGGGGTGCCAGTCAAGGCGACGCATCTCGACGGCCA
CGACTCGCTGCTCAGCATCGTGCAGATGCCTAGAGGCGTGCCGGTAGCGACGGTCGGCATCAACAACAGCGTCAA
TGCTGCGCTGCTGGCCGTCAGGATACTAGGTGCGCACAGGGCAGAGTATCGCGAGAGGATGGAGCGCTATATGAA
GGGGTTGAAGACTGAGGTCGAGGACAAGGCGGCCAAACTAGAGGAGGTTGGTTATGAGGCGTATCTAGAGGAGAA
GAAGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail