Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00519
Gene name
Locationscaffold_01:2132880..2133610
Strand+
Gene length (bp)730
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05856 ARPC4 ARP2/3 complex 20 kDa subunit (ARPC4) 2.2E-78 1 166

GO

GO Term Description Terminal node
GO:0015629 actin cytoskeleton Yes
GO:0030041 actin filament polymerization Yes
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0043933 protein-containing complex organization No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0065003 protein-containing complex assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0032991 protein-containing complex No
GO:0097435 supramolecular fiber organization No
GO:0008154 actin polymerization or depolymerization No
GO:0007015 actin filament organization No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0051258 protein polymerization No
GO:0005856 cytoskeleton No
GO:0045010 actin nucleation No
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0008150 biological_process No
GO:0043228 non-membrane-bounded organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.4018 0.3011 0.1489 0.0774 0.6572 0.0964 0.1096 0.0909 0.1334 0.0632

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3919
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2232
Ophiocordyceps australis map64 (Brazil) OphauB2|720
Ophiocordyceps camponoti-floridani Ophcf2|00519 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5479
Ophiocordyceps kimflemingae Ophio5|1242
Ophiocordyceps subramaniannii Hirsu2|7805

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00519
MSQSLRPYLQCVRSSLTAALTLSNFASQTAERHNVPEIEAQTSPEVLLTPLTVSRNENERVLIEPSINSIRISIK
IKQADEIEHILVHKFTRFLTQRAESFFILRRKPIKGYDISFLITNFHTDEMLKHKLVDFIIQFMEDVDKEISEMK
LFLNARARFVAESFLTPFD*
Coding >Ophcf2|00519
ATGTCTCAATCCCTTCGGCCGTACCTGCAATGCGTCCGCAGCAGCTTGACGGCCGCCCTGACGTTGTCCAACTTT
GCCTCGCAGACGGCGGAGCGGCACAACGTGCCAGAGATCGAGGCTCAGACATCGCCCGAGGTGCTGCTGACGCCC
TTGACGGTGTCGCGTAATGAGAACGAAAGGGTCCTGATCGAGCCGAGCATCAACTCGATCCGCATCAGCATCAAG
ATCAAGCAGGCCGACGAGATCGAGCACATCCTTGTCCACAAGTTCACCCGCTTCTTGACTCAACGAGCAGAGTCT
TTCTTTATTTTGCGTCGCAAACCAATCAAGGGCTATGACATTTCTTTCCTCATCACAAACTTCCACACGGACGAG
ATGCTCAAGCACAAACTTGTCGACTTCATCATTCAGTTTATGGAGGACGTCGACAAGGAGATATCCGAGATGAAG
CTCTTTCTCAACGCGAGAGCGAGATTCGTCGCAGAGTCATTTTTAACTCCGTTTGACTAG
Transcript >Ophcf2|00519
ATGTCTCAATCCCTTCGGCCGTACCTGCAATGCGTCCGCAGCAGCTTGACGGCCGCCCTGACGTTGTCCAACTTT
GCCTCGCAGACGGCGGAGCGGCACAACGTGCCAGAGATCGAGGCTCAGACATCGCCCGAGGTGCTGCTGACGCCC
TTGACGGTGTCGCGTAATGAGAACGAAAGGGTCCTGATCGAGCCGAGCATCAACTCGATCCGCATCAGCATCAAG
ATCAAGCAGGCCGACGAGATCGAGCACATCCTTGTCCACAAGTTCACCCGCTTCTTGACTCAACGAGCAGAGTCT
TTCTTTATTTTGCGTCGCAAACCAATCAAGGGCTATGACATTTCTTTCCTCATCACAAACTTCCACACGGACGAG
ATGCTCAAGCACAAACTTGTCGACTTCATCATTCAGTTTATGGAGGACGTCGACAAGGAGATATCCGAGATGAAG
CTCTTTCTCAACGCGAGAGCGAGATTCGTCGCAGAGTCATTTTTAACTCCGTTTGACTAG
Gene >Ophcf2|00519
ATGGTGAGCTGCTGCTGTTAAATTCGAGAGAATCTTCACCGTGCTGATCGATTTAAAATCAAATCAGTCTCAATC
CCTTCGGCCGTACCTGCAATGCGTCCGCAGCAGCTTGACGGCCGCCCTGACGTTGTCCAACTTTGCCTCGCAGAC
GGCGGAGCGGCACAACGTGCCAGAGATCGAGGCTCAGACATCGCCCGAGGTGCTGCTGACGCCCTTGACGGTGTC
GCGTAATGAGAACGAAAGGGTCCTGATCGAGCCGAGCATCAACTCGATCCGCATCAGCATCAAGATCAAGCAGGC
CGACGAGATCGAGCACATCCTTGTCCACAAGTTCACCCGCTTCTTGACTCAACGAGCAGAGTCTTTCTTTATTTT
GCGTCGCAAACCAATCAAGGTTCGTCTCCGTGGTGCCTAGATAACTGGAAGCTGACGGCTCGCCGCCAGGGCTAT
GACATTTCTTTCCTCATCACAAACTTCCACACGGACGAGATGCTCAAGCACAAACTTGTCGACTTCATCATTCAG
TTTATGGAGGACGTCGACAAGGAGATATCCGAGATGAAGCTCTTTGTAGGTTCCCAGCCCGCGATGGTGTGGCAC
ACGGCTGACACTTGACAGCTCAACGCGAGAGCGAGATTCGTCGCAGAGTCATTTTTAACTCCGGTACATTGATTG
TTCCTCTCGCTAGGCCTTTGTTGTCTCGCTGACGTTGGCCGTATAGTTTGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail