Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00513
Gene name
Locationscaffold_01:2122013..2123700
Strand-
Gene length (bp)1687
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 1.9E-115 33 438

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0072488 ammonium transmembrane transport Yes
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0015267 channel activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0006812 cation transport No
GO:0008324 cation transmembrane transporter activity No
GO:0022803 passive transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0098660 inorganic ion transmembrane transport No
GO:0071705 nitrogen compound transport No
GO:0015075 ion transmembrane transporter activity No
GO:0005261 cation channel activity No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0005216 ion channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 61 83 22
3 121 143 22
4 148 170 22
5 185 207 22
6 220 242 22
7 252 274 22
8 286 308 22
9 312 334 22
10 341 363 22
11 387 409 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 56.71 32.13 81.30
Alive In ants, during behavior modification 553.49 222.34 884.64
Dead In ants, recently dead 1292.35 446.17 2138.53

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00513
MATAYNGTNSTADDGSSTGASNLNVFYDTGHLAFLTVSSVLVLLMIPGVGFFYSGLARRKSALQLVLLSMLSVAV
IGFQWFFWGYSLAFSRTGNAFLGDLSQFGLMKTIAQPNGSSFLPDILFCLYQGMFASITPALAIGAVADRGRILP
ALVFMFVWSTAVYDPIAYWTWNTNGWLYKLPSYDFAGGGPVHISSGTCALAYSLMLGRRTGYSSNGGLPYRPHSV
TNVVLGTVFLWVGWFGFNGGSALGMNLRAVMACYVSNLAASCAGITWVLLDYRLERKWSTIGFCSGAISGLVAIT
PAAGFVTPWAAVVIGVCGALCCNFATKLKFLLGVDDALDIFAVHGVGGIVGNILTGIFGASYIASLDGQSYPPIG
WVERHWVQLGKQLAGICAAFAWSFTLSCLILFLMNLVPGLSLRVSADDEVVGIDDCQLGEFAYDYVELTRHVADD
ITTVSDRNASSDGEKNVATPTAALTP*
Coding >Ophcf2|00513
ATGGCGACGGCCTACAATGGCACCAACAGCACCGCTGACGATGGCTCTTCAACCGGGGCGTCCAACCTCAACGTC
TTCTACGACACGGGCCATTTGGCCTTTCTGACGGTGTCGTCTGTGCTGGTGCTGCTCATGATTCCCGGCGTCGGC
TTCTTCTACAGCGGTCTTGCCCGTCGCAAATCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTC
ATCGGCTTCCAATGGTTCTTTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGAAACGCCTTTCTCGGTGATCTA
TCGCAGTTTGGCCTGATGAAGACGATTGCTCAGCCCAATGGCTCTAGCTTTCTGCCCGACATTCTCTTTTGCCTC
TACCAGGGCATGTTCGCCTCCATCACACCGGCACTAGCCATCGGAGCCGTGGCCGATCGCGGTCGCATCTTACCG
GCCCTCGTCTTCATGTTCGTCTGGTCGACTGCGGTGTACGACCCGATCGCCTACTGGACGTGGAACACGAACGGC
TGGCTCTACAAGCTACCGAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCCCTC
GCCTACAGCCTGATGCTCGGCCGTCGAACGGGCTACTCCAGCAACGGCGGACTCCCCTACCGACCGCACAGCGTG
ACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGTCGGCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATG
AACCTCCGGGCCGTCATGGCCTGCTACGTCAGTAACCTCGCCGCCTCATGCGCCGGAATCACATGGGTCCTACTC
GACTACCGACTCGAGCGCAAATGGTCCACCATTGGCTTCTGCTCCGGCGCCATCTCGGGCCTCGTCGCCATCACC
CCGGCCGCCGGCTTCGTCACCCCCTGGGCAGCCGTCGTCATCGGCGTCTGCGGCGCCCTGTGCTGCAACTTTGCC
ACCAAGCTCAAGTTCCTCCTCGGCGTCGACGACGCCCTCGACATCTTTGCCGTCCACGGCGTCGGCGGCATCGTC
GGCAATATCCTAACCGGCATCTTTGGCGCCTCCTACATCGCCTCCCTAGACGGCCAATCCTACCCCCCCATAGGC
TGGGTAGAGCGCCACTGGGTCCAACTCGGCAAGCAACTGGCCGGCATCTGCGCCGCCTTCGCCTGGTCCTTTACC
CTCTCCTGCCTCATCCTCTTCCTCATGAACCTCGTACCGGGCCTCTCGCTACGCGTCTCTGCAGACGACGAGGTG
GTCGGTATAGACGACTGCCAACTCGGTGAATTCGCCTACGATTACGTGGAACTCACCCGCCACGTCGCCGATGAC
ATCACCACCGTCTCCGACCGCAACGCCTCCTCCGACGGCGAAAAGAACGTCGCCACCCCGACCGCCGCCCTCACC
CCGTGA
Transcript >Ophcf2|00513
ATGGCGACGGCCTACAATGGCACCAACAGCACCGCTGACGATGGCTCTTCAACCGGGGCGTCCAACCTCAACGTC
TTCTACGACACGGGCCATTTGGCCTTTCTGACGGTGTCGTCTGTGCTGGTGCTGCTCATGATTCCCGGCGTCGGC
TTCTTCTACAGCGGTCTTGCCCGTCGCAAATCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTC
ATCGGCTTCCAATGGTTCTTTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGAAACGCCTTTCTCGGTGATCTA
TCGCAGTTTGGCCTGATGAAGACGATTGCTCAGCCCAATGGCTCTAGCTTTCTGCCCGACATTCTCTTTTGCCTC
TACCAGGGCATGTTCGCCTCCATCACACCGGCACTAGCCATCGGAGCCGTGGCCGATCGCGGTCGCATCTTACCG
GCCCTCGTCTTCATGTTCGTCTGGTCGACTGCGGTGTACGACCCGATCGCCTACTGGACGTGGAACACGAACGGC
TGGCTCTACAAGCTACCGAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCCCTC
GCCTACAGCCTGATGCTCGGCCGTCGAACGGGCTACTCCAGCAACGGCGGACTCCCCTACCGACCGCACAGCGTG
ACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGTCGGCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATG
AACCTCCGGGCCGTCATGGCCTGCTACGTCAGTAACCTCGCCGCCTCATGCGCCGGAATCACATGGGTCCTACTC
GACTACCGACTCGAGCGCAAATGGTCCACCATTGGCTTCTGCTCCGGCGCCATCTCGGGCCTCGTCGCCATCACC
CCGGCCGCCGGCTTCGTCACCCCCTGGGCAGCCGTCGTCATCGGCGTCTGCGGCGCCCTGTGCTGCAACTTTGCC
ACCAAGCTCAAGTTCCTCCTCGGCGTCGACGACGCCCTCGACATCTTTGCCGTCCACGGCGTCGGCGGCATCGTC
GGCAATATCCTAACCGGCATCTTTGGCGCCTCCTACATCGCCTCCCTAGACGGCCAATCCTACCCCCCCATAGGC
TGGGTAGAGCGCCACTGGGTCCAACTCGGCAAGCAACTGGCCGGCATCTGCGCCGCCTTCGCCTGGTCCTTTACC
CTCTCCTGCCTCATCCTCTTCCTCATGAACCTCGTACCGGGCCTCTCGCTACGCGTCTCTGCAGACGACGAGGTG
GTCGGTATAGACGACTGCCAACTCGGTGAATTCGCCTACGATTACGTGGAACTCACCCGCCACGTCGCCGATGAC
ATCACCACCGTCTCCGACCGCAACGCCTCCTCCGACGGCGAAAAGAACGTCGCCACCCCGACCGCCGCCCTCACC
CCGTGA
Gene >Ophcf2|00513
ATGGCGACGGCCTACAATGGCACCAACAGCACCGCTGACGATGGCTCTTCAACCGGGGCGTCCAACCTCAACGTC
TTCTACGACGTACGTCTTTCCTCCGGACCTCGTTCGCGGCTTCTAACGGGTCGCAGACGGGCCATTTGGCCTTTC
TGACGGTGTCGTCTGTGCTGGTGCTGCTCATGATTCCCGGCGTCGGCTTCTTCTACAGCGGTCTTGCCCGTCGCA
AATCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTCATCGGCTTCCAATGGTTCTTTTGGGGAT
ACTCGCTCGCCTTTTCCCGCACCGGAAACGCCTTTCTCGGTGATCTATCGCAGTTTGGCCTGATGAAGACGATTG
CTCAGCCCAATGGCTCTAGCTTTCTGCCCGACATTCTCTTTTGCCTCTACCAGGGCATGTTCGCCTCCATCACGT
TCGTCCACGACACCCCTTGATTCTTACTCATTCCGGACTGATGGTATTGACGCAAGTCTCGCAGACCGGCACTAG
CCATCGGAGCCGTGGCCGATCGCGGTCGCATCTTACCGGCCCTCGTCTTCATGTTCGTCTGGTCGACTGCGGTGT
ACGACCCGATCGCCTACTGGACGTGGAACACGAACGGCTGGCTCTACAAGCTACCGAGCTACGACTTCGCCGGCG
GCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCCCTCGCCTACAGCCTGATGCTCGGCCGTCGAACGGGCTACT
CCAGCAACGGCGGACTCCCCTACCGACCGCACAGCGTGACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGTCG
GCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATGAACCTCCGGGCCGTCATGGCCTGCTACGTCAGTAACC
TCGCCGCCTCATGCGCCGGAATCACATGGGTCCTACTCGACTACCGACTCGAGCGCAAATGGTCCACCATTGGCT
TCTGCTCCGGCGCCATCTCGGGCCTCGTCGCCATCACCCCGGCCGCCGGCTTCGTCACCCCCTGGGCAGCCGTCG
TCATCGGCGTCTGCGGCGCCCTGTGCTGCAACTTTGCCACCAAGCTCAAGTTCCTCCTCGGCGTCGACGACGCCC
TCGACATCTTTGCCGTCCACGGCGTCGGCGGCATCGTCGGCAATATCCTAACCGGCATCTTTGGCGCGTACGTCT
TCTCTCTTCTACCCTCTCCTCTCCTCTCCTCTCTCCCTCCCTCCCTCCCTCCCTCCCCTCCTCTCCTCTCTTCCT
CACCCACCAATTCCATCTCACTAACAACCCCCCCCTCCCCCCCTTCCTCGGGGTAAACAGCTCCTACATCGCCTC
CCTAGACGGCCAATCCTACCCCCCCATAGGCTGGGTAGAGCGCCACTGGGTCCAACTCGGCAAGCAACTGGCCGG
CATCTGCGCCGCCTTCGCCTGGTCCTTTACCCTCTCCTGCCTCATCCTCTTCCTCATGAACCTCGTACCGGGCCT
CTCGCTACGCGTCTCTGCAGACGACGAGGTGGTCGGTATAGACGACTGCCAACTCGGTGAATTCGCCTACGATTA
CGTGGAACTCACCCGCCACGTCGCCGATGACATCACCACCGTCTCCGACCGCAACGCCTCCTCCGACGGCGAAAA
GAACGTCGCCACCCCGACCGCCGCCCTCACCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail