Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00513
Gene name
Locationscaffold_01:2122013..2123700
Strand-
Gene length (bp)1687
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 1.9E-115 33 438

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0072488 ammonium transmembrane transport Yes
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0015267 channel activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0006812 cation transport No
GO:0008324 cation transmembrane transporter activity No
GO:0022803 passive transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0098660 inorganic ion transmembrane transport No
GO:0071705 nitrogen compound transport No
GO:0015075 ion transmembrane transporter activity No
GO:0005261 cation channel activity No
GO:0055085 transmembrane transport No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0005216 ion channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 61 83 22
3 121 143 22
4 148 170 22
5 185 207 22
6 220 242 22
7 252 274 22
8 286 308 22
9 312 334 22
10 341 363 22
11 387 409 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00513
MATAYNGTNSTADDGSSTGASNLNVFYDTGHLAFLTVSSVLVLLMIPGVGFFYSGLARRKSALQLVLLSMLSVAV
IGFQWFFWGYSLAFSRTGNAFLGDLSQFGLMKTIAQPNGSSFLPDILFCLYQGMFASITPALAIGAVADRGRILP
ALVFMFVWSTAVYDPIAYWTWNTNGWLYKLPSYDFAGGGPVHISSGTCALAYSLMLGRRTGYSSNGGLPYRPHSV
TNVVLGTVFLWVGWFGFNGGSALGMNLRAVMACYVSNLAASCAGITWVLLDYRLERKWSTIGFCSGAISGLVAIT
PAAGFVTPWAAVVIGVCGALCCNFATKLKFLLGVDDALDIFAVHGVGGIVGNILTGIFGASYIASLDGQSYPPIG
WVERHWVQLGKQLAGICAAFAWSFTLSCLILFLMNLVPGLSLRVSADDEVVGIDDCQLGEFAYDYVELTRHVADD
ITTVSDRNASSDGEKNVATPTAALTP*
Coding >Ophcf2|00513
ATGGCGACGGCCTACAATGGCACCAACAGCACCGCTGACGATGGCTCTTCAACCGGGGCGTCCAACCTCAACGTC
TTCTACGACACGGGCCATTTGGCCTTTCTGACGGTGTCGTCTGTGCTGGTGCTGCTCATGATTCCCGGCGTCGGC
TTCTTCTACAGCGGTCTTGCCCGTCGCAAATCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTC
ATCGGCTTCCAATGGTTCTTTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGAAACGCCTTTCTCGGTGATCTA
TCGCAGTTTGGCCTGATGAAGACGATTGCTCAGCCCAATGGCTCTAGCTTTCTGCCCGACATTCTCTTTTGCCTC
TACCAGGGCATGTTCGCCTCCATCACACCGGCACTAGCCATCGGAGCCGTGGCCGATCGCGGTCGCATCTTACCG
GCCCTCGTCTTCATGTTCGTCTGGTCGACTGCGGTGTACGACCCGATCGCCTACTGGACGTGGAACACGAACGGC
TGGCTCTACAAGCTACCGAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCCCTC
GCCTACAGCCTGATGCTCGGCCGTCGAACGGGCTACTCCAGCAACGGCGGACTCCCCTACCGACCGCACAGCGTG
ACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGTCGGCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATG
AACCTCCGGGCCGTCATGGCCTGCTACGTCAGTAACCTCGCCGCCTCATGCGCCGGAATCACATGGGTCCTACTC
GACTACCGACTCGAGCGCAAATGGTCCACCATTGGCTTCTGCTCCGGCGCCATCTCGGGCCTCGTCGCCATCACC
CCGGCCGCCGGCTTCGTCACCCCCTGGGCAGCCGTCGTCATCGGCGTCTGCGGCGCCCTGTGCTGCAACTTTGCC
ACCAAGCTCAAGTTCCTCCTCGGCGTCGACGACGCCCTCGACATCTTTGCCGTCCACGGCGTCGGCGGCATCGTC
GGCAATATCCTAACCGGCATCTTTGGCGCCTCCTACATCGCCTCCCTAGACGGCCAATCCTACCCCCCCATAGGC
TGGGTAGAGCGCCACTGGGTCCAACTCGGCAAGCAACTGGCCGGCATCTGCGCCGCCTTCGCCTGGTCCTTTACC
CTCTCCTGCCTCATCCTCTTCCTCATGAACCTCGTACCGGGCCTCTCGCTACGCGTCTCTGCAGACGACGAGGTG
GTCGGTATAGACGACTGCCAACTCGGTGAATTCGCCTACGATTACGTGGAACTCACCCGCCACGTCGCCGATGAC
ATCACCACCGTCTCCGACCGCAACGCCTCCTCCGACGGCGAAAAGAACGTCGCCACCCCGACCGCCGCCCTCACC
CCGTGA
Transcript >Ophcf2|00513
ATGGCGACGGCCTACAATGGCACCAACAGCACCGCTGACGATGGCTCTTCAACCGGGGCGTCCAACCTCAACGTC
TTCTACGACACGGGCCATTTGGCCTTTCTGACGGTGTCGTCTGTGCTGGTGCTGCTCATGATTCCCGGCGTCGGC
TTCTTCTACAGCGGTCTTGCCCGTCGCAAATCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTC
ATCGGCTTCCAATGGTTCTTTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGAAACGCCTTTCTCGGTGATCTA
TCGCAGTTTGGCCTGATGAAGACGATTGCTCAGCCCAATGGCTCTAGCTTTCTGCCCGACATTCTCTTTTGCCTC
TACCAGGGCATGTTCGCCTCCATCACACCGGCACTAGCCATCGGAGCCGTGGCCGATCGCGGTCGCATCTTACCG
GCCCTCGTCTTCATGTTCGTCTGGTCGACTGCGGTGTACGACCCGATCGCCTACTGGACGTGGAACACGAACGGC
TGGCTCTACAAGCTACCGAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCCCTC
GCCTACAGCCTGATGCTCGGCCGTCGAACGGGCTACTCCAGCAACGGCGGACTCCCCTACCGACCGCACAGCGTG
ACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGTCGGCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATG
AACCTCCGGGCCGTCATGGCCTGCTACGTCAGTAACCTCGCCGCCTCATGCGCCGGAATCACATGGGTCCTACTC
GACTACCGACTCGAGCGCAAATGGTCCACCATTGGCTTCTGCTCCGGCGCCATCTCGGGCCTCGTCGCCATCACC
CCGGCCGCCGGCTTCGTCACCCCCTGGGCAGCCGTCGTCATCGGCGTCTGCGGCGCCCTGTGCTGCAACTTTGCC
ACCAAGCTCAAGTTCCTCCTCGGCGTCGACGACGCCCTCGACATCTTTGCCGTCCACGGCGTCGGCGGCATCGTC
GGCAATATCCTAACCGGCATCTTTGGCGCCTCCTACATCGCCTCCCTAGACGGCCAATCCTACCCCCCCATAGGC
TGGGTAGAGCGCCACTGGGTCCAACTCGGCAAGCAACTGGCCGGCATCTGCGCCGCCTTCGCCTGGTCCTTTACC
CTCTCCTGCCTCATCCTCTTCCTCATGAACCTCGTACCGGGCCTCTCGCTACGCGTCTCTGCAGACGACGAGGTG
GTCGGTATAGACGACTGCCAACTCGGTGAATTCGCCTACGATTACGTGGAACTCACCCGCCACGTCGCCGATGAC
ATCACCACCGTCTCCGACCGCAACGCCTCCTCCGACGGCGAAAAGAACGTCGCCACCCCGACCGCCGCCCTCACC
CCGTGA
Gene >Ophcf2|00513
ATGGCGACGGCCTACAATGGCACCAACAGCACCGCTGACGATGGCTCTTCAACCGGGGCGTCCAACCTCAACGTC
TTCTACGACGTACGTCTTTCCTCCGGACCTCGTTCGCGGCTTCTAACGGGTCGCAGACGGGCCATTTGGCCTTTC
TGACGGTGTCGTCTGTGCTGGTGCTGCTCATGATTCCCGGCGTCGGCTTCTTCTACAGCGGTCTTGCCCGTCGCA
AATCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTCATCGGCTTCCAATGGTTCTTTTGGGGAT
ACTCGCTCGCCTTTTCCCGCACCGGAAACGCCTTTCTCGGTGATCTATCGCAGTTTGGCCTGATGAAGACGATTG
CTCAGCCCAATGGCTCTAGCTTTCTGCCCGACATTCTCTTTTGCCTCTACCAGGGCATGTTCGCCTCCATCACGT
TCGTCCACGACACCCCTTGATTCTTACTCATTCCGGACTGATGGTATTGACGCAAGTCTCGCAGACCGGCACTAG
CCATCGGAGCCGTGGCCGATCGCGGTCGCATCTTACCGGCCCTCGTCTTCATGTTCGTCTGGTCGACTGCGGTGT
ACGACCCGATCGCCTACTGGACGTGGAACACGAACGGCTGGCTCTACAAGCTACCGAGCTACGACTTCGCCGGCG
GCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCCCTCGCCTACAGCCTGATGCTCGGCCGTCGAACGGGCTACT
CCAGCAACGGCGGACTCCCCTACCGACCGCACAGCGTGACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGTCG
GCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATGAACCTCCGGGCCGTCATGGCCTGCTACGTCAGTAACC
TCGCCGCCTCATGCGCCGGAATCACATGGGTCCTACTCGACTACCGACTCGAGCGCAAATGGTCCACCATTGGCT
TCTGCTCCGGCGCCATCTCGGGCCTCGTCGCCATCACCCCGGCCGCCGGCTTCGTCACCCCCTGGGCAGCCGTCG
TCATCGGCGTCTGCGGCGCCCTGTGCTGCAACTTTGCCACCAAGCTCAAGTTCCTCCTCGGCGTCGACGACGCCC
TCGACATCTTTGCCGTCCACGGCGTCGGCGGCATCGTCGGCAATATCCTAACCGGCATCTTTGGCGCGTACGTCT
TCTCTCTTCTACCCTCTCCTCTCCTCTCCTCTCTCCCTCCCTCCCTCCCTCCCTCCCCTCCTCTCCTCTCTTCCT
CACCCACCAATTCCATCTCACTAACAACCCCCCCCTCCCCCCCTTCCTCGGGGTAAACAGCTCCTACATCGCCTC
CCTAGACGGCCAATCCTACCCCCCCATAGGCTGGGTAGAGCGCCACTGGGTCCAACTCGGCAAGCAACTGGCCGG
CATCTGCGCCGCCTTCGCCTGGTCCTTTACCCTCTCCTGCCTCATCCTCTTCCTCATGAACCTCGTACCGGGCCT
CTCGCTACGCGTCTCTGCAGACGACGAGGTGGTCGGTATAGACGACTGCCAACTCGGTGAATTCGCCTACGATTA
CGTGGAACTCACCCGCCACGTCGCCGATGACATCACCACCGTCTCCGACCGCAACGCCTCCTCCGACGGCGAAAA
GAACGTCGCCACCCCGACCGCCGCCCTCACCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail