Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00506
Gene name
Locationscaffold_01:2100280..2102919
Strand+
Gene length (bp)2639
Transcript length (bp)2364
Coding sequence length (bp)2364
Protein length (aa) 788

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain 1.3E-57 275 422
PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain 1.3E-39 90 245
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 1.2E-27 547 642
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 4.8E-23 662 770
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 3.3E-15 494 554

GO

GO Term Description Terminal node
GO:0030151 molybdenum ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6891 0.3022 0.0541 0.0566 0.4194 0.073 0.3087 0.1302 0.4157 0.135

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5124
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6677
Ophiocordyceps australis map64 (Brazil) OphauB2|4353
Ophiocordyceps camponoti-floridani Ophcf2|00506 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6217
Ophiocordyceps kimflemingae Ophio5|4190
Ophiocordyceps subramaniannii Hirsu2|3404

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00506
MDISSSSSSNDGFNTPSTELAPAPTYPLPPEASLSAVLAEDVKTPDKHVPRDSRLIRLTGLHPFNAEAPLSKLYD
EGSLTTDNLHYVRNHGAVPRCHDRDVDSWTFSIRGLVAHPLTLSLRDLYSYDQVTYPVTLVCAGNRRKEQNTVRK
SKGFSWGSAGLSTALWTGIAIGQLLARAEPLKGARYIWCMDASKGILVAYKMNGLALSPDHGKPVRLIVPGQIGG
RSVKWLKKIMVTAEPSDNWYHIYDNRVLPTSISPEASADPSNSYIWKDERHAIYDLNVNSAICHPAHDESIVTSS
LLDTYQVRGYAYCGGGRRISRVEVTLDQGRTWKLADVDYPEDQYREAAADEELFGGKLDVWWRETCFCWCFWSVD
VPVTELAASKDVMVRAMDDGLMVQQRDMYWNVLGMMNNNWFRVVLHRERGGSLLRFEHPTQPALNPGGWMERVKG
MGGDLLNGFWGQDLAGLQDGQGFAEENEEDISMVNSEVDRVISIEELEAHGNESSPWFVVQGQVYDGTPFLDDHP
GGAASITGVAAQDASDEFLAIHLSHDVKIFRFKLQHQNQQLGLPVGQHVLLRLASSSTLIRAYTPISPVSTRGSV
DVLVKIYRPWADQKRATMTQTLDSIPLGSPVDFKGPLGKFEYRGRGVCIVAGATIHVRRLYMMCAGSGITPIFQV
LQAISKDEHDQTECVVLYGNRTEEDVLCRRELDDIFGGGRRGRLRLTLTRPSASWTGRKGRIDEAMLEKDVGPCD
ETAADHLALVCGPRMLEANVRRVLLRMGWRDRDVVLF*
Coding >Ophcf2|00506
ATGGACATCTCGTCCTCCAGCAGCAGCAACGACGGCTTCAACACGCCGTCGACGGAACTGGCCCCAGCCCCGACC
TACCCCCTACCGCCCGAAGCCAGCCTCTCAGCTGTTCTAGCAGAAGACGTCAAGACTCCCGATAAGCACGTACCG
CGAGACTCGCGCCTCATCCGTCTAACCGGACTTCATCCCTTCAACGCCGAGGCCCCGTTGAGCAAGCTCTACGAT
GAGGGCTCCCTCACAACCGACAACCTACACTACGTCCGGAACCACGGCGCCGTCCCTCGATGCCATGACCGTGAT
GTAGACAGCTGGACCTTTTCCATTCGAGGCCTCGTCGCTCATCCACTGACGCTCAGCTTGAGGGACTTGTACTCG
TACGACCAAGTCACTTACCCCGTCACCCTCGTCTGCGCGGGAAACCGACGCAAAGAGCAAAACACGGTCCGCAAA
TCCAAGGGTTTCTCATGGGGATCTGCCGGCCTTTCCACCGCTCTCTGGACGGGCATCGCCATCGGACAGTTGCTT
GCTCGGGCCGAGCCCCTGAAAGGTGCCCGATATATCTGGTGCATGGACGCGTCCAAGGGGATCCTGGTTGCTTAT
AAGATGAATGGGCTTGCTCTCAGTCCCGACCACGGGAAGCCTGTCCGTCTTATCGTTCCGGGTCAGATCGGAGGC
CGCAGCGTCAAGTGGCTCAAGAAGATCATGGTGACGGCAGAACCGAGCGACAACTGGTATCACATCTACGATAAC
CGCGTGCTGCCGACGAGCATCAGCCCCGAAGCCAGCGCCGATCCTTCCAACTCTTACATCTGGAAGGACGAGAGA
CACGCCATCTACGACCTCAACGTCAACAGCGCCATATGTCATCCAGCCCACGACGAATCCATCGTCACCTCCAGC
CTCCTCGACACGTATCAAGTCCGAGGGTACGCGTACTGCGGTGGCGGCCGGAGAATCAGCAGAGTCGAAGTCACC
CTCGACCAGGGCCGGACGTGGAAGCTGGCAGACGTCGACTATCCGGAAGACCAGTACAGAGAGGCAGCGGCAGAC
GAGGAGCTCTTTGGCGGCAAGCTCGACGTCTGGTGGAGGGAGACGTGCTTCTGTTGGTGCTTCTGGTCGGTGGAC
GTGCCCGTTACGGAGCTCGCGGCCTCCAAGGACGTCATGGTGCGAGCCATGGACGATGGTCTGATGGTTCAGCAG
CGGGATATGTACTGGAACGTCTTGGGCATGATGAACAATAACTGGTTCAGAGTCGTCCTTCACCGAGAACGGGGA
GGGAGCCTGCTCAGATTCGAGCATCCGACTCAGCCAGCCCTGAATCCAGGCGGATGGATGGAGAGGGTCAAGGGG
ATGGGCGGGGATCTACTCAACGGCTTCTGGGGTCAGGATCTGGCGGGACTCCAAGACGGACAGGGGTTTGCGGAG
GAGAATGAGGAGGATATATCCATGGTGAACAGCGAGGTCGATCGGGTCATCAGCATCGAGGAGCTCGAGGCTCAC
GGGAACGAGTCGAGCCCCTGGTTCGTCGTTCAGGGGCAAGTCTACGATGGTACGCCTTTCCTGGATGATCATCCC
GGCGGAGCAGCCTCCATCACCGGCGTGGCCGCACAGGACGCATCAGATGAGTTTCTGGCCATCCACCTCTCACAC
GACGTCAAGATATTCCGCTTCAAACTCCAGCATCAAAATCAACAACTCGGCTTGCCCGTCGGTCAGCACGTCCTC
TTGCGTCTCGCCTCGTCCTCCACCTTGATCCGCGCCTACACGCCCATATCACCCGTGTCGACGAGAGGAAGCGTG
GATGTGCTCGTCAAGATCTACCGCCCCTGGGCAGATCAGAAACGAGCGACGATGACGCAAACGCTAGACTCGATT
CCACTCGGCAGCCCTGTCGACTTCAAAGGCCCGCTGGGAAAGTTCGAATACCGGGGCAGAGGAGTCTGTATCGTA
GCCGGTGCTACTATCCATGTCCGCCGCCTGTACATGATGTGCGCAGGCTCCGGCATCACGCCCATCTTTCAAGTC
TTGCAGGCTATTTCGAAAGACGAGCATGATCAGACCGAATGCGTCGTCTTGTACGGCAACCGCACAGAGGAAGAT
GTTCTCTGCCGCCGCGAGCTCGACGACATCTTCGGGGGAGGCAGACGGGGAAGATTACGGCTTACATTGACGAGG
CCCTCGGCATCCTGGACGGGGCGAAAGGGCCGCATCGACGAGGCTATGCTGGAGAAGGATGTAGGGCCTTGTGAT
GAGACGGCAGCCGACCATCTGGCTCTGGTGTGCGGGCCGCGGATGTTGGAGGCGAATGTTCGGCGTGTGCTTTTG
CGGATGGGGTGGAGGGATAGAGACGTTGTCTTGTTCTGA
Transcript >Ophcf2|00506
ATGGACATCTCGTCCTCCAGCAGCAGCAACGACGGCTTCAACACGCCGTCGACGGAACTGGCCCCAGCCCCGACC
TACCCCCTACCGCCCGAAGCCAGCCTCTCAGCTGTTCTAGCAGAAGACGTCAAGACTCCCGATAAGCACGTACCG
CGAGACTCGCGCCTCATCCGTCTAACCGGACTTCATCCCTTCAACGCCGAGGCCCCGTTGAGCAAGCTCTACGAT
GAGGGCTCCCTCACAACCGACAACCTACACTACGTCCGGAACCACGGCGCCGTCCCTCGATGCCATGACCGTGAT
GTAGACAGCTGGACCTTTTCCATTCGAGGCCTCGTCGCTCATCCACTGACGCTCAGCTTGAGGGACTTGTACTCG
TACGACCAAGTCACTTACCCCGTCACCCTCGTCTGCGCGGGAAACCGACGCAAAGAGCAAAACACGGTCCGCAAA
TCCAAGGGTTTCTCATGGGGATCTGCCGGCCTTTCCACCGCTCTCTGGACGGGCATCGCCATCGGACAGTTGCTT
GCTCGGGCCGAGCCCCTGAAAGGTGCCCGATATATCTGGTGCATGGACGCGTCCAAGGGGATCCTGGTTGCTTAT
AAGATGAATGGGCTTGCTCTCAGTCCCGACCACGGGAAGCCTGTCCGTCTTATCGTTCCGGGTCAGATCGGAGGC
CGCAGCGTCAAGTGGCTCAAGAAGATCATGGTGACGGCAGAACCGAGCGACAACTGGTATCACATCTACGATAAC
CGCGTGCTGCCGACGAGCATCAGCCCCGAAGCCAGCGCCGATCCTTCCAACTCTTACATCTGGAAGGACGAGAGA
CACGCCATCTACGACCTCAACGTCAACAGCGCCATATGTCATCCAGCCCACGACGAATCCATCGTCACCTCCAGC
CTCCTCGACACGTATCAAGTCCGAGGGTACGCGTACTGCGGTGGCGGCCGGAGAATCAGCAGAGTCGAAGTCACC
CTCGACCAGGGCCGGACGTGGAAGCTGGCAGACGTCGACTATCCGGAAGACCAGTACAGAGAGGCAGCGGCAGAC
GAGGAGCTCTTTGGCGGCAAGCTCGACGTCTGGTGGAGGGAGACGTGCTTCTGTTGGTGCTTCTGGTCGGTGGAC
GTGCCCGTTACGGAGCTCGCGGCCTCCAAGGACGTCATGGTGCGAGCCATGGACGATGGTCTGATGGTTCAGCAG
CGGGATATGTACTGGAACGTCTTGGGCATGATGAACAATAACTGGTTCAGAGTCGTCCTTCACCGAGAACGGGGA
GGGAGCCTGCTCAGATTCGAGCATCCGACTCAGCCAGCCCTGAATCCAGGCGGATGGATGGAGAGGGTCAAGGGG
ATGGGCGGGGATCTACTCAACGGCTTCTGGGGTCAGGATCTGGCGGGACTCCAAGACGGACAGGGGTTTGCGGAG
GAGAATGAGGAGGATATATCCATGGTGAACAGCGAGGTCGATCGGGTCATCAGCATCGAGGAGCTCGAGGCTCAC
GGGAACGAGTCGAGCCCCTGGTTCGTCGTTCAGGGGCAAGTCTACGATGGTACGCCTTTCCTGGATGATCATCCC
GGCGGAGCAGCCTCCATCACCGGCGTGGCCGCACAGGACGCATCAGATGAGTTTCTGGCCATCCACCTCTCACAC
GACGTCAAGATATTCCGCTTCAAACTCCAGCATCAAAATCAACAACTCGGCTTGCCCGTCGGTCAGCACGTCCTC
TTGCGTCTCGCCTCGTCCTCCACCTTGATCCGCGCCTACACGCCCATATCACCCGTGTCGACGAGAGGAAGCGTG
GATGTGCTCGTCAAGATCTACCGCCCCTGGGCAGATCAGAAACGAGCGACGATGACGCAAACGCTAGACTCGATT
CCACTCGGCAGCCCTGTCGACTTCAAAGGCCCGCTGGGAAAGTTCGAATACCGGGGCAGAGGAGTCTGTATCGTA
GCCGGTGCTACTATCCATGTCCGCCGCCTGTACATGATGTGCGCAGGCTCCGGCATCACGCCCATCTTTCAAGTC
TTGCAGGCTATTTCGAAAGACGAGCATGATCAGACCGAATGCGTCGTCTTGTACGGCAACCGCACAGAGGAAGAT
GTTCTCTGCCGCCGCGAGCTCGACGACATCTTCGGGGGAGGCAGACGGGGAAGATTACGGCTTACATTGACGAGG
CCCTCGGCATCCTGGACGGGGCGAAAGGGCCGCATCGACGAGGCTATGCTGGAGAAGGATGTAGGGCCTTGTGAT
GAGACGGCAGCCGACCATCTGGCTCTGGTGTGCGGGCCGCGGATGTTGGAGGCGAATGTTCGGCGTGTGCTTTTG
CGGATGGGGTGGAGGGATAGAGACGTTGTCTTGTTCTGA
Gene >Ophcf2|00506
ATGGACATCTCGTCCTCCAGCAGCAGCAACGACGGCTTCAACACGCCGTCGACGGAACTGGCCCCAGCCCCGACC
TACCCCCTACCGCCCGAAGCCAGCCTCTCAGCTGTTCTAGCAGAAGACGTCAAGACTCCCGATAAGCACGTACCG
CGAGACTCGCGCCTCATCCGTCTAACCGGACTTCATCCCTTCAACGCCGAGGCCCCGTTGAGCAAGCTCTACGAT
GAGGGCTCCCTCACAACCGACAACCTACACTACGTCCGGAACCACGGCGCCGTCCCTCGATGCCATGACCGTGAT
GTAGACAGCTGGACCTTTTCCATTCGAGGCCTCGTCGCTCATCCACTGACGCTCAGCTTGAGGGACTTGTACTCG
TACGACCAAGTCACTTACCCCGTCACCCTCGTCTGCGCGGGAAACCGACGCAAAGAGCAAAACACGGTCCGCAAA
TCCAAGGGTTTCTCATGGGGATCTGCCGGCCTTTCCACCGCTCTCTGGACGGGCATCGCCATCGGACAGTTGCTT
GCTCGGGCCGAGCCCCTGAAAGGTGCCCGATATATGTGTGCTTCGAAGGCGTCGACGAGCTTCCCAATGGCTGCT
ACGGCACGTCTGTCAAGCTCAGCTGGTGCATGGACGCGTCCAAGGGGATCCTGGTTGCTTATAAGATGAATGGGC
TTGCTCTCAGTCCCGACCACGGGAAGCCTGTCCGTCTTATCGTTCCGGGTCAGATCGGAGGCCGCAGCGTCAAGT
GGCTCAAGAAGATCATGGTGACGGCAGAACCGAGCGACAACTGGTATCACATCTACGATAACCGCGTGCTGCCGA
CGAGCATCAGCCCCGAAGCCAGCGCCGATCCTTCCAACTCTTACATCTGGAAGGACGAGAGACACGCCATCTACG
ACCTCAACGTCAACAGCGCCATATGTCATCCAGCCCACGACGAATCCATCGTCACCTCCAGCCTCCTCGACACGT
ATCAAGTCCGAGGGTACGCGTACTGCGGTGGCGGCCGGAGAATCAGCAGAGTCGAAGTCACCCTCGACCAGGGCC
GGACGTGGAAGCTGGCAGACGTCGACTATCCGGAAGACCAGTACAGAGAGGCAGCGGCAGACGAGGAGCTCTTTG
GCGGCAAGCTCGACGTCTGGTGGAGGGAGACGTGCTTCTGTTGGTGCTTCTGGTCGGTGGACGTGCCCGTTACGG
AGCTCGCGGCCTCCAAGGACGTCATGGTGCGAGCCATGGACGATGGTCTGATGGTTCAGCAGCGGGATATGTACT
GGAACGTCTTGGGCATGATGAACAATAACTGGTTCAGAGTCGTCCTTCACCGAGAACGGGGAGGGAGCCTGCTCA
GATTCGAGCATCCGACTCAGCCAGCCCTGAATCCAGGCGGATGGATGGAGAGGGTCAAGGGGATGGGCGGGGATC
TACTCAACGGCTTCTGGGGTCAGGATCTGGCGGGACTCCAAGACGGACAGGGGTTTGCGGAGGAGAATGAGGAGG
ATATATCCATGGTGAACAGCGAGGTCGATCGGGTCATCAGCATCGAGGAGCTCGAGGCTCACGGGAACGAGTCGA
GCCCCTGGTTCGTCGTTCAGGGGCAAGTCTACGATGGTACGCCTTTCCTGGATGATCATCCCGGCGGAGCAGCCT
CCATCACCGGCGTGGCCGCACAGGACGCATCAGATGAGTTTCTGGCCATCCGTACGTCTCATTCCTAGCAGCAGA
TGACTGAGGTCGGCTGATGATGATGGCAAGACAGCCAAACTGCCAAGAGGAAGATGAGCAGCCATCACATCGGCT
CGCTCGAAACAGCCCTCACAGAGTGACCAAGCCCTATCCGCGAGCCCGAAACCAACCGTCCCCTCTTCCTCGCGT
CAAATCAGTGGACAACGGCCACTCTACAGACGAAGCAAGACCTCTCACACGACGTCAAGATATTCCGCTTCAAAC
TCCAGCATCAAAATCAACAACTCGGCTTGCCCGTCGGTCAGCACGTCCTCTTGCGTCTCGCCTCGTCCTCCACCT
TGATCCGCGCCTACACGCCCATATCACCCGTGTCGACGAGAGGAAGCGTGGATGTGCTCGTCAAGATCTACCGCC
CCTGGGCAGATCAGAAACGAGCGACGATGACGCAAACGCTAGACTCGATTCCACTCGGCAGCCCTGTCGACTTCA
AAGGCCCGCTGGGAAAGTTCGAATACCGGGGCAGAGGAGTCTGTATCGTAGCCGGTGCTACTATCCATGTCCGCC
GCCTGTACATGATGTGCGCAGGCTCCGGCATCACGCCCATCTTTCAAGTCTTGCAGGCTATTTCGAAAGACGAGC
ATGATCAGACCGAATGCGTCGTCTTGTACGGCAACCGCACAGAGGAAGATGTTCTCTGCCGCCGCGAGCTCGACG
ACATCTTCGGGGGAGGCAGACGGGGAAGATTACGGCTTACATTGACGAGGCCCTCGGCATCCTGGACGGGGCGAA
AGGGCCGCATCGACGAGGCTATGCTGGAGAAGGATGTAGGGCCTTGTGATGAGACGGCAGCCGACCATCTGGCTC
TGGTGTGCGGGCCGCGGATGTTGGAGGCGAATGTTCGGCGTGTGCTTTTGCGGATGGGGTGGAGGGATAGAGACG
TTGTCTTGTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail