Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00491
Gene name
Locationscaffold_01:2059650..2064359
Strand-
Gene length (bp)4709
Transcript length (bp)2442
Coding sequence length (bp)2442
Protein length (aa) 814

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 1.4E-47 349 778
PF01693 Cauli_VI Caulimovirus viroplasmin 2.4E-18 25 68
PF01693 Cauli_VI Caulimovirus viroplasmin 5.2E-16 83 126
PF00075 RNase_H RNase H 2.8E-25 186 295

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0003676 nucleic acid binding Yes
GO:0004523 RNA-DNA hybrid ribonuclease activity Yes
GO:0016021 integral component of membrane Yes
GO:1901363 heterocyclic compound binding No
GO:0004519 endonuclease activity No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0022804 active transmembrane transporter activity No
GO:0005488 binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0022857 transmembrane transporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0003824 catalytic activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0015297 antiporter activity No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No
GO:0004540 ribonuclease activity No
GO:0006811 ion transport No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0004518 nuclease activity No
GO:0004521 endoribonuclease activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 300 322 22
2 342 364 22
3 448 470 22
4 475 497 22
5 518 540 22
6 550 572 22
7 593 615 22
8 671 690 19
9 711 733 22
10 760 782 22
11 794 811 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00491
MNKNRPAPTASSNLSKKRRTDGLPKFYAVRAGFKPGIYLNYSDCQQQTAGFKGAVFKSFTSRDDAEAFVAGKKVA
ADAGEPAKFYAVAVGSPTGIYTDWNDAAAAIKGVKGPKYKRFATRAEAVAYIKQFGNRETVEALGEMGYSVDSDD
DDDSDDDDGDDPLELSSGKKRAAAAAAAAASSEDVLKIWTDGSSLANGKVGSRAGVGVFFGDGDARNVSERLEGE
LQTNQRAELMAMVRALQIAPRAQTVQIVSDSQYSINCVTQWAIGWKLKDWMTATGEKVKNQDLIRAVLDKIDERT
LAGANTFLVALCVGYWAAAAAAHPISPPRRDAIWRVPLQPSNFNVTLSVLGGFISLFGLVSFLVKENYYLSEALI
SLVAGIALGPKGANWLRPREYAECDAQVSEQDCVANVDDVTMAFSRLVLGVQLVLAGVQLPSRYLWSERRALLLL
VGPGMAAMWLATSGLVWLVVRPASVLHALAVGACVTPTDPVLSAVIVKGKFADRNIPVQLQHLVIAESGSNDGLG
YPFLFFALYLIKFAGQGTSGLRDALGLWFALTWVYTIALGIAYGAVVGLVGKTLLHWAERRHYVDRESFLVFAIS
LALFVVGTCGLLGTDDVLACFIAGNTFTWDDWFRLRTKDDSLQPTVDMLLNVAIFLWYGAALPWDSFGRNSVPGL
STGRLVALGALVLLLRRLPWVFCMRRWIHQVEGLRHAVFVGFFGPIGVSAVFYIFVALDFIRLHLSGEDGSARGD
VVHLSETIRVVVWFLVVCSVVVHGLSIPIGKLGYLAPRTVSSKNMFAALVIPALVIPALIIRA*
Coding >Ophcf2|00491
ATGAATAAGAATAGGCCCGCACCGACGGCTTCGTCCAATCTGTCCAAAAAGAGGAGGACGGATGGCCTGCCCAAA
TTCTACGCGGTTCGCGCCGGCTTCAAGCCCGGTATTTACCTGAACTATTCCGACTGTCAGCAGCAGACGGCAGGC
TTCAAGGGCGCTGTCTTCAAGTCGTTTACGTCGCGCGATGACGCAGAGGCCTTTGTGGCAGGCAAAAAGGTGGCG
GCAGACGCCGGAGAGCCGGCCAAGTTCTACGCAGTCGCCGTCGGCAGCCCGACCGGCATCTATACCGATTGGAAC
GACGCGGCGGCCGCCATCAAGGGGGTCAAGGGTCCCAAGTACAAGCGCTTCGCCACGCGCGCCGAGGCCGTGGCC
TACATCAAGCAGTTCGGCAACAGGGAGACCGTCGAGGCCCTGGGCGAGATGGGCTACTCCGTCGACAGCGACGAC
GATGACGACAGCGATGACGATGACGGAGACGACCCCCTCGAGCTGTCGAGCGGCAAGAAACGGGCGGCGGCGGCG
GCGGCGGCGGCGGCGTCATCCGAGGACGTGCTCAAGATATGGACGGACGGCAGCAGCTTGGCCAACGGCAAGGTG
GGCTCGCGGGCCGGCGTCGGTGTCTTCTTCGGCGACGGCGACGCACGCAACGTGTCGGAACGGCTCGAGGGAGAG
CTGCAGACGAACCAGCGGGCCGAGTTGATGGCCATGGTGCGGGCGCTGCAGATAGCGCCACGGGCGCAGACGGTG
CAGATTGTCAGCGACAGCCAGTACTCCATCAACTGCGTGACGCAGTGGGCAATCGGGTGGAAGCTCAAGGACTGG
ATGACGGCGACGGGTGAAAAGGTCAAGAACCAGGACCTGATCCGGGCCGTGCTCGACAAGATTGACGAGCGAACG
CTGGCCGGGGCCAACACGTTTCTCGTTGCTCTGTGTGTTGGTTACTGGGCTGCTGCTGCTGCTGCTCATCCCATC
TCGCCGCCTCGACGGGACGCCATCTGGAGGGTCCCTCTACAACCTTCAAACTTCAACGTCACCCTCTCCGTACTG
GGAGGCTTCATCTCACTCTTCGGCCTCGTCTCATTCCTCGTCAAGGAGAATTACTACCTCTCCGAAGCACTCATC
TCGCTGGTAGCAGGCATCGCCCTCGGTCCCAAAGGCGCAAACTGGCTCCGTCCCCGCGAGTACGCGGAATGCGAC
GCCCAGGTCAGCGAACAAGACTGTGTAGCCAACGTCGACGACGTCACCATGGCCTTCTCGCGACTCGTCCTTGGC
GTACAGCTCGTGTTGGCCGGTGTGCAGCTTCCCAGTCGCTATCTCTGGTCCGAGAGGCGGGCGTTGCTGCTGCTC
GTTGGGCCGGGCATGGCGGCCATGTGGCTTGCTACCAGTGGGCTCGTCTGGTTGGTTGTTCGGCCGGCGAGCGTG
CTTCATGCCTTGGCGGTGGGAGCGTGTGTGACGCCTACGGATCCCGTTCTTTCGGCCGTCATTGTCAAGGGGAAA
TTCGCGGATCGGAATATCCCCGTTCAGCTACAGCATCTGGTCATCGCCGAGTCTGGATCCAACGATGGACTGGGT
TACCCCTTTCTCTTCTTCGCCCTCTACCTCATCAAGTTCGCGGGACAGGGCACCTCTGGACTGAGGGACGCGCTG
GGCCTGTGGTTCGCCTTGACGTGGGTTTATACCATTGCTCTGGGCATCGCTTACGGGGCCGTCGTGGGACTCGTC
GGTAAGACGCTTCTTCACTGGGCGGAGCGTCGTCACTACGTTGATAGGGAGAGCTTCCTCGTCTTCGCCATCTCG
CTCGCTCTCTTCGTCGTCGGCACCTGCGGCTTGCTCGGCACCGACGACGTGCTGGCCTGCTTCATCGCGGGAAAC
ACGTTTACCTGGGACGATTGGTTCCGACTACGAACAAAAGACGACTCGCTACAGCCGACGGTCGACATGCTCCTC
AACGTCGCCATCTTCCTATGGTACGGCGCCGCGCTGCCGTGGGATAGCTTCGGGCGGAACAGCGTGCCGGGCCTC
TCGACGGGGAGGTTGGTGGCGTTGGGGGCGCTGGTGTTGCTGCTGCGGCGGTTACCGTGGGTGTTTTGCATGAGG
AGATGGATTCATCAGGTCGAGGGATTGCGTCACGCCGTCTTTGTGGGATTCTTTGGTCCCATTGGCGTCTCGGCT
GTCTTTTACATCTTTGTCGCGCTCGACTTTATCCGTCTTCATCTGAGCGGGGAGGACGGCTCAGCGAGGGGAGAC
GTGGTTCACCTATCGGAAACGATCCGCGTCGTCGTCTGGTTCCTCGTCGTCTGCAGCGTCGTCGTCCACGGACTT
AGCATTCCGATCGGGAAGCTGGGATACTTGGCCCCGCGCACAGTTTCTAGTAAAAACATGTTCGCAGCCCTCGTC
ATCCCAGCCCTCGTCATCCCAGCCCTCATCATCCGCGCCTAG
Transcript >Ophcf2|00491
ATGAATAAGAATAGGCCCGCACCGACGGCTTCGTCCAATCTGTCCAAAAAGAGGAGGACGGATGGCCTGCCCAAA
TTCTACGCGGTTCGCGCCGGCTTCAAGCCCGGTATTTACCTGAACTATTCCGACTGTCAGCAGCAGACGGCAGGC
TTCAAGGGCGCTGTCTTCAAGTCGTTTACGTCGCGCGATGACGCAGAGGCCTTTGTGGCAGGCAAAAAGGTGGCG
GCAGACGCCGGAGAGCCGGCCAAGTTCTACGCAGTCGCCGTCGGCAGCCCGACCGGCATCTATACCGATTGGAAC
GACGCGGCGGCCGCCATCAAGGGGGTCAAGGGTCCCAAGTACAAGCGCTTCGCCACGCGCGCCGAGGCCGTGGCC
TACATCAAGCAGTTCGGCAACAGGGAGACCGTCGAGGCCCTGGGCGAGATGGGCTACTCCGTCGACAGCGACGAC
GATGACGACAGCGATGACGATGACGGAGACGACCCCCTCGAGCTGTCGAGCGGCAAGAAACGGGCGGCGGCGGCG
GCGGCGGCGGCGGCGTCATCCGAGGACGTGCTCAAGATATGGACGGACGGCAGCAGCTTGGCCAACGGCAAGGTG
GGCTCGCGGGCCGGCGTCGGTGTCTTCTTCGGCGACGGCGACGCACGCAACGTGTCGGAACGGCTCGAGGGAGAG
CTGCAGACGAACCAGCGGGCCGAGTTGATGGCCATGGTGCGGGCGCTGCAGATAGCGCCACGGGCGCAGACGGTG
CAGATTGTCAGCGACAGCCAGTACTCCATCAACTGCGTGACGCAGTGGGCAATCGGGTGGAAGCTCAAGGACTGG
ATGACGGCGACGGGTGAAAAGGTCAAGAACCAGGACCTGATCCGGGCCGTGCTCGACAAGATTGACGAGCGAACG
CTGGCCGGGGCCAACACGTTTCTCGTTGCTCTGTGTGTTGGTTACTGGGCTGCTGCTGCTGCTGCTCATCCCATC
TCGCCGCCTCGACGGGACGCCATCTGGAGGGTCCCTCTACAACCTTCAAACTTCAACGTCACCCTCTCCGTACTG
GGAGGCTTCATCTCACTCTTCGGCCTCGTCTCATTCCTCGTCAAGGAGAATTACTACCTCTCCGAAGCACTCATC
TCGCTGGTAGCAGGCATCGCCCTCGGTCCCAAAGGCGCAAACTGGCTCCGTCCCCGCGAGTACGCGGAATGCGAC
GCCCAGGTCAGCGAACAAGACTGTGTAGCCAACGTCGACGACGTCACCATGGCCTTCTCGCGACTCGTCCTTGGC
GTACAGCTCGTGTTGGCCGGTGTGCAGCTTCCCAGTCGCTATCTCTGGTCCGAGAGGCGGGCGTTGCTGCTGCTC
GTTGGGCCGGGCATGGCGGCCATGTGGCTTGCTACCAGTGGGCTCGTCTGGTTGGTTGTTCGGCCGGCGAGCGTG
CTTCATGCCTTGGCGGTGGGAGCGTGTGTGACGCCTACGGATCCCGTTCTTTCGGCCGTCATTGTCAAGGGGAAA
TTCGCGGATCGGAATATCCCCGTTCAGCTACAGCATCTGGTCATCGCCGAGTCTGGATCCAACGATGGACTGGGT
TACCCCTTTCTCTTCTTCGCCCTCTACCTCATCAAGTTCGCGGGACAGGGCACCTCTGGACTGAGGGACGCGCTG
GGCCTGTGGTTCGCCTTGACGTGGGTTTATACCATTGCTCTGGGCATCGCTTACGGGGCCGTCGTGGGACTCGTC
GGTAAGACGCTTCTTCACTGGGCGGAGCGTCGTCACTACGTTGATAGGGAGAGCTTCCTCGTCTTCGCCATCTCG
CTCGCTCTCTTCGTCGTCGGCACCTGCGGCTTGCTCGGCACCGACGACGTGCTGGCCTGCTTCATCGCGGGAAAC
ACGTTTACCTGGGACGATTGGTTCCGACTACGAACAAAAGACGACTCGCTACAGCCGACGGTCGACATGCTCCTC
AACGTCGCCATCTTCCTATGGTACGGCGCCGCGCTGCCGTGGGATAGCTTCGGGCGGAACAGCGTGCCGGGCCTC
TCGACGGGGAGGTTGGTGGCGTTGGGGGCGCTGGTGTTGCTGCTGCGGCGGTTACCGTGGGTGTTTTGCATGAGG
AGATGGATTCATCAGGTCGAGGGATTGCGTCACGCCGTCTTTGTGGGATTCTTTGGTCCCATTGGCGTCTCGGCT
GTCTTTTACATCTTTGTCGCGCTCGACTTTATCCGTCTTCATCTGAGCGGGGAGGACGGCTCAGCGAGGGGAGAC
GTGGTTCACCTATCGGAAACGATCCGCGTCGTCGTCTGGTTCCTCGTCGTCTGCAGCGTCGTCGTCCACGGACTT
AGCATTCCGATCGGGAAGCTGGGATACTTGGCCCCGCGCACAGTTTCTAGTAAAAACATGTTCGCAGCCCTCGTC
ATCCCAGCCCTCGTCATCCCAGCCCTCATCATCCGCGCCTAG
Gene >Ophcf2|00491
ATGAATAAGAATAGGCCCGCACCGACGGCTTCGTCCAATCTGTCCAAAAAGAGGAGGACGGATGGCCTGCCCAAA
TTCTACGCGGTTCGCGCCGGCTTCAAGCCCGGTATTTACCTGAACTATTCCGACTGTCAGCAGCAGACGGCAGGC
TTCAAGGGCGCTGTCTGTGAGTTTCTCCTCGTCGTCGCTCCCTCTCCCAACGGGGGACTGACGCTCCGCCAGTCA
AGTCGTTTACGTCGCGCGATGACGCAGAGGCCTTTGTGGCAGGCAAAAAGGTGGCGGCAGACGCCGGAGAGCCGG
CCAAGTTCTACGCAGTCGCCGTCGGCAGCCCGACCGGCATCTATACCGATTGGAACGACGCGGCGGCCGCCATCA
AGGGGGTCAAGGGTCCCAAGTACAAGCGCTTCGCCACGCGCGCCGAGGCCGTGGCCTACATCAAGCAGTTCGGCA
ACAGGGAGACCGTCGAGGCCCTGGGCGAGATGGGCTACTCCGTCGACAGCGACGACGATGACGACAGCGATGACG
ATGACGGAGACGACCCCCTCGAGCTGTCGAGCGGCAAGAAACGGGCGGCGGCGGCGGCGGCGGCGGCGGCGTCAT
CCGAGGACGTGCTCAAGATATGGACGGACGGCAGCAGCTTGGCCAACGGCAAGGTGGGCTCGCGGGCCGGCGTCG
GTGTCTTCTTCGGCGACGGCGACGCACGCAACGTGTCGGAACGGCTCGAGGGAGAGCTGCAGACGAACCAGCGGG
CCGAGTTGATGGCCATGGTGCGGGCGCTGCAGATAGCGCCACGGGCGCAGACGGTGCAGATTGTCAGCGACAGCC
AGTACTCCATCAACTGCGTGACGCAGTGGGCAATCGGGTGGAAGCTCAAGGACTGGATGACGGCGACGGGTGAAA
AGGTCAAGAACCAGGACCTGATCCGGGCCGTGCTCGACAAGATTGACGAGCGAACGCTGGCCGGGGCCAACACGT
ACTTCCACTGGGTCAAGGGCCACTCTGCGGATCGCGGTAACCGGGCGGCTGATCGGCTGGCGGTCCGGGGCGCCA
AGATTGGCTTCGGTTGAGTCGAGGCGGGGAAACGAGGCTCTTTTGGAGAGTCCAACGCACACATGCTCACATATG
TACAGACAAACGCATGCAGTGCCACTTGGCGTCCTGGTTTCTTTGTCGTTATCACTCGGCCTCGATGTAGGAACA
AGATTAGGAGAATAGAAGAGCGTCGCACCGACGAATATGCGATGGCACCGTCTTCACGCCCGAGTGGCCAGTGTC
ATGGGGTGAGATGGAGCTGGTGAGTGCCGCCTGTCGATGGACCTTGCTCTTGCTGTATGGCGTGTTTTGAAATAT
AAAAAGTCGTTGATGCCTCTGCTGTTGTTAGTCTGTTGGACGGAAACCCGTTTGTGGTATAGGGTAGGGTAGGGA
AGAGGAGCAAGATAAGCAAGAGAAGCAGAAGAAGACGCCGAGCACGTGAGTTTTCCCGATAAGTCTCCTTTCCTC
TTCAGACCAAGTTTCATCGTCAGACACGTGAGCTGCCGTCTCTGCGGAACGATCAGCGAATGAAGAAGAGAGAAA
AAAAAGGAACGGTGAGAAAGAGGAGAAGGGACGATCGGGCTTAGACCGAAGAGGGGGGATCGGCCACATGACCGA
GTCTGGTGGCATCCGGAGGGGGGGGAGGGGTGATGGTGAGGAAAGGTGAGAGAGCGGGTGACTGACTGACGGGGA
ACGAGCAGGTGAACGAGGGACGAGGGACGTGCGAGCATTTGACTGGTTTTCTTGCACTGACGACGGCTGTTTCGC
TTTGGGGTCGAGCGGTTGTTACCTTGGCTTGGTTGATTCTGAGCTGGCTTTTTTCTTTGTTTTTTTTTCTTTGCG
TCTTTGCGTCTCTGCGTCTTTGTTGCTGGTGAGTTTAAGGGTTTCATCCAAGGTTTCTCGTTGCTCTGTGTGTTG
GTTACTGGGTGAGTTGGTCGTCTTGCATTCCGTTGAAGCTGGGTTGCAGATTGGAGGGCGGTTCGAGTTACGGGC
TTGCTGTGGGATTTGCGTGGCTGACTTTCTTTCTCTTCTGGTAGGCTGCTGCTGCTGCTGCTGTTGGTACTCGTG
TCCGACTGAGTCTTTACCGGTTGGAGGGGATCCAAGATATCGGGTGCGGTTGGATTTCTCTCTACGATCCGACAC
TGCCTGCCCTGCCATTGCAATCATGGCTTCTCTTCAGCATCCCATCTCGCCGCCTCGACGGGACGCCATCTGGAG
GGTCCCTCTACAACCTTCAAACTTCAACGTCACCCTCTCCGTACTGGGAGGCTTCATCTCACTCTTCGGCCTCGT
CTCATTCCTCGTCAAGGAGAATTACTACCTCTCCGAAGCACGTCAGTAACTAACCCCCCCCCCCCCACCTTACAC
CTCTCTTCGTTCCGTCTCTGACCAACTTGATAAAGTCATCTCGCTGGTAGCAGGCATCGCCCTCGGTCCCAAAGG
CGCAAACTGGCTCCGTCCCCGCGAGTACGCGGAATGCGACGCCCAGGTCAGCGAACAAGACTGTGTAGCCAACGT
CGACGACGTCACCATGGCCTTCTCGCGACTCGTCCTTGGCGTACAGCTCGTGTTGGCCGGTGTGCAGCTTCCCAG
TCGCTATCTCTGGTCCGAGAGGCGGGCGTTGCTGCTGCTCGTTGGGCCGGGCATGGCGGCCATGTGGCTTGCTAC
CAGTGGGCTCGTCTGGTTGGTTGTTCGGCCGGCGAGCGTGCTTCATGCCTTGGCGGTGGGAGCGTGTGTGACGCC
TACGGATCCCGTTCTTTCGGCCGTCATTGTCAAGGGGAAATTCGCGGATCGGAATATCCCCGTTCAGCTACAGCA
TCTGGTCATCGCCGAGTCTGGATCCAACGATGGACTGGGTTACCCCTTTCTCTTCTTCGCCCTCTACCTCATCAA
GTTCGCGGGACAGGGCACCTCTGGACTGAGGGACGCGCTGGGCCTGTGGTTCGCCTTGACGTGGGTTTATACCAT
TGCTCTGGGCATCGCTTACGGGGCCGTCGTGGGACTCGTCGGTAAGACGCTTCTTCACTGGGCGGAGCGTCGTCA
CTACGTTGATAGGGAGAGCTTCCTCGTCTTCGCCATCTCGCTCGCTCTCTTCGTCGTCGGCACCTGCGGCTTGCT
CGGCACCGACGACGTGCTGGCCTGCTTCATCGCGGGAAACACGTTTACCTGGGACGATTGGTTCCGACTACGAAC
AAAAGACGACTCGCTACAGCCGACGGTCGACATGCTCCTCAACGTCGCCATCTTCCTATGGTACGGCGCCGCGCT
GCCGTGGGATAGCTTCGGGCGGAACAGCGTGCCGGGCCTCTCGACGGGGAGGTTGGTGGCGTTGGGGGCGCTGGT
GTTGCTGCTGCGGCGGTTACCGTGGGTGTTTTGCATGAGGAGATGGATTCATCAGGTCGAGGGATTGCGTCACGC
CGTCTTTGTGGGATTCTTTGGTCCCATTGGCGTCTCGGCTGTCTTTTACATCTTTGTCGCGCTCGACTTTATCCG
TCTTCATCTGAGCGGGGAGGACGGCTCAGCGAGGGGAGACGTGGTTCACCTATCGGAAACGATCCGCGTCGTCGT
CTGGTTCCTCGTCGTCTGCAGCGTCGTCGTCCACGGACTTAGCATTCCGATCGGGAAGCTGGGATACTTGGCCCC
GCGGTTCGGCCGTGTGCTGGACGAGCCCTTGCGGCGGTCGAGGGTTGCGAGGTTGGGGGATGGCTCGGGAGGAAG
AGGGGGATGGGAAGGTGTTGGTTCGCCTTTGGTTGATGAGTTTGGGGGTTGGGATGGGGATGAGTAAAGGGAGGG
GGGAAAGAGAGGAGGGAGGAGGGTTGGGATTGATGGGCTCGGGGGTTTGGTAGAGCCTAGAGGAGTTGCGGCGGG
ATGGGGAAGTTTGTGATGTGAAGGGGATGGCTGTGCTTGGGGGTTTTGATCAGATACATTGTTGGGTTAATGATG
GGATTGTTGGTTGATGGGTGTTTCTGTTGTTGAAGCTATGGGGTTGTGCCTATTGGCTACGGCTATTCTCTTTTG
CCGGTTCACACGTGATGGATCTTTCAGTCGCATCAGCGTGGCAGTTTACGGAAGAAGATGACAGGTAAATATATA
TATATATATATATATCTCATCTTACACTGGCAACATGATGTTAATCAGAGATGTACAATGTAAAAGAATAGCTTC
ATCGGCTTCATCCACCTCCCCTCATCCCTCCCCCCAACCTCTTGAAGAATGATGCCAACGAAAGCGAGATGACGA
GAACACGTGGACATACATATGTACAGCCAGGTTTCCTCCTCCCACGGCATCCGAACCTCCCTCTCACAGCCACGC
GTCCCGCCTTTTTCTCTGGGGTGTACATGGAGTGCTGGACTGCGGGCTGGGCGTGAGGTGAAGTGTGGCTTGTGA
TTGGCTTGCTCGTGCGGGAGGATGGTTCGGCAGGGGCGCGTGTTGTGCGCGTCATTGGGGGTTGCTGTCGGATGA
TTGATCGTCTGCTGAAGCATTCATCGTCTGCTGGAGAATCGTCTGCCAGAAAATGGTCTGCCACGCATCAACCAT
TCCATATATGATAAATCCCCATAAGTAGGATCCAGACGATATTCACATCAACTAGCACAGTTTCTAGTAAAAACA
TGTTCGCAGCCCTCGTCATCCCAGCCCTCGTCATCCCAGCCCTCATCATCCGCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail