Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00483
Gene name
Locationscaffold_01:2038870..2040018
Strand+
Gene length (bp)1148
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05841 Apc15p Apc15p protein 2.7E-17 39 102

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0030071 regulation of mitotic metaphase/anaphase transition Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0010965 regulation of mitotic sister chromatid separation No
GO:0044265 cellular macromolecule catabolic process No
GO:1905818 regulation of chromosome separation No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0008152 metabolic process No
GO:0050794 regulation of cellular process No
GO:0000151 ubiquitin ligase complex No
GO:0010564 regulation of cell cycle process No
GO:0009056 catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:1901990 regulation of mitotic cell cycle phase transition No
GO:0050789 regulation of biological process No
GO:1901987 regulation of cell cycle phase transition No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:1990234 transferase complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0051983 regulation of chromosome segregation No
GO:0071704 organic substance metabolic process No
GO:0044248 cellular catabolic process No
GO:1902494 catalytic complex No
GO:0051128 regulation of cellular component organization No
GO:0033044 regulation of chromosome organization No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0008150 biological_process No
GO:0140535 intracellular protein-containing complex No
GO:1901575 organic substance catabolic process No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0065007 biological regulation No
GO:0051726 regulation of cell cycle No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0033043 regulation of organelle organization No
GO:0009057 macromolecule catabolic process No
GO:0030163 protein catabolic process No
GO:0140513 nuclear protein-containing complex No
GO:1902099 regulation of metaphase/anaphase transition of cell cycle No
GO:0006807 nitrogen compound metabolic process No
GO:0033045 regulation of sister chromatid segregation No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0019538 protein metabolic process No
GO:0007346 regulation of mitotic cell cycle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4135 0.8364 0.0129 0.04 0.2184 0.0022 0.0251 0.0903 0.024 0.064

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5949
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3258
Ophiocordyceps australis map64 (Brazil) OphauB2|7665
Ophiocordyceps camponoti-floridani Ophcf2|00483 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2056
Ophiocordyceps kimflemingae Ophio5|7090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00483
MSTILPDFTPRDSHSLWFASSRAPLPLHDGRNASAGHGPQAMRSARGHMMERTALARLRADEQAQLWRRAHVQNF
GSAWLKPPGVPKTLHQMREEKREQQEHQEAVRREQLAQELAEAEAAGLPDDGMMDDVQLDGAQDLDNQVPDADEE
YAMDEDEDDEDDELDEGDVVVVDDDDGHNDQDEMDDEADAQREEDRQNDLAAARMRMADDAFREALVRGDADTDD
MYGAEDQATDQQGQDYMLDEDDLVHRLSTEDDAQPLNMDADLDDDIPEAESGRYEHTDSDAGVSSTSDEDDQDDD
QDDSLVHDHRLLSASRQGPPQSPTMPRRGTPVAPRTTDVDLLLSQDGSSLISNDGSPVLSRRP*
Coding >Ophcf2|00483
ATGTCCACGATATTGCCGGACTTTACGCCGAGAGATTCGCATTCCCTGTGGTTCGCGTCCTCTCGAGCACCCTTG
CCGCTTCACGATGGCCGCAACGCGTCAGCCGGCCACGGACCCCAAGCCATGCGCTCCGCTCGTGGACACATGATG
GAGCGGACCGCGCTGGCGAGGCTCCGAGCAGACGAGCAGGCTCAGCTTTGGCGACGAGCTCATGTGCAGAACTTT
GGCAGCGCCTGGCTGAAGCCGCCCGGCGTGCCCAAGACTCTCCACCAGATGCGAGAGGAGAAGCGCGAGCAGCAG
GAGCATCAGGAGGCTGTTCGCCGCGAACAACTCGCTCAGGAGCTGGCTGAGGCTGAGGCTGCCGGCTTACCTGAC
GACGGCATGATGGATGATGTCCAGCTCGACGGCGCGCAGGACCTCGACAACCAAGTTCCCGATGCTGACGAAGAG
TATGCCATGGACGAGGACGAGGACGACGAGGACGACGAGCTCGATGAGGGCGACGTTGTTGTTGTTGATGACGAC
GACGGCCATAACGATCAAGACGAGATGGACGACGAAGCCGACGCTCAGAGGGAAGAAGACCGGCAGAACGACCTC
GCGGCCGCCCGGATGCGAATGGCCGACGACGCCTTCCGAGAAGCCCTCGTCCGCGGAGACGCCGACACCGACGAC
ATGTACGGCGCCGAAGACCAAGCCACCGACCAGCAAGGACAAGACTACATGCTCGACGAAGACGACCTCGTCCAC
AGGCTCTCCACCGAAGACGACGCTCAGCCCCTCAACATGGACGCCGATCTCGACGATGACATCCCCGAAGCCGAG
AGCGGCCGCTACGAGCACACCGACTCCGACGCCGGCGTCAGCTCCACCAGCGACGAAGATGATCAAGACGACGAC
CAAGACGACAGCCTCGTCCACGATCATCGCCTTCTTTCCGCCTCGAGGCAGGGCCCGCCTCAGTCCCCAACCATG
CCCCGTCGAGGTACCCCCGTCGCGCCACGGACAACCGACGTTGACCTCCTCCTTTCCCAGGACGGCAGCAGTCTC
ATCAGCAACGATGGCAGCCCTGTGCTGAGCCGGAGGCCCTGA
Transcript >Ophcf2|00483
ATGTCCACGATATTGCCGGACTTTACGCCGAGAGATTCGCATTCCCTGTGGTTCGCGTCCTCTCGAGCACCCTTG
CCGCTTCACGATGGCCGCAACGCGTCAGCCGGCCACGGACCCCAAGCCATGCGCTCCGCTCGTGGACACATGATG
GAGCGGACCGCGCTGGCGAGGCTCCGAGCAGACGAGCAGGCTCAGCTTTGGCGACGAGCTCATGTGCAGAACTTT
GGCAGCGCCTGGCTGAAGCCGCCCGGCGTGCCCAAGACTCTCCACCAGATGCGAGAGGAGAAGCGCGAGCAGCAG
GAGCATCAGGAGGCTGTTCGCCGCGAACAACTCGCTCAGGAGCTGGCTGAGGCTGAGGCTGCCGGCTTACCTGAC
GACGGCATGATGGATGATGTCCAGCTCGACGGCGCGCAGGACCTCGACAACCAAGTTCCCGATGCTGACGAAGAG
TATGCCATGGACGAGGACGAGGACGACGAGGACGACGAGCTCGATGAGGGCGACGTTGTTGTTGTTGATGACGAC
GACGGCCATAACGATCAAGACGAGATGGACGACGAAGCCGACGCTCAGAGGGAAGAAGACCGGCAGAACGACCTC
GCGGCCGCCCGGATGCGAATGGCCGACGACGCCTTCCGAGAAGCCCTCGTCCGCGGAGACGCCGACACCGACGAC
ATGTACGGCGCCGAAGACCAAGCCACCGACCAGCAAGGACAAGACTACATGCTCGACGAAGACGACCTCGTCCAC
AGGCTCTCCACCGAAGACGACGCTCAGCCCCTCAACATGGACGCCGATCTCGACGATGACATCCCCGAAGCCGAG
AGCGGCCGCTACGAGCACACCGACTCCGACGCCGGCGTCAGCTCCACCAGCGACGAAGATGATCAAGACGACGAC
CAAGACGACAGCCTCGTCCACGATCATCGCCTTCTTTCCGCCTCGAGGCAGGGCCCGCCTCAGTCCCCAACCATG
CCCCGTCGAGGTACCCCCGTCGCGCCACGGACAACCGACGTTGACCTCCTCCTTTCCCAGGACGGCAGCAGTCTC
ATCAGCAACGATGGCAGCCCTGTGCTGAGCCGGAGGCCCTGA
Gene >Ophcf2|00483
ATGTCCACGATATTGCCGGACTTTACGCCGAGAGATGTTCGTTTCTGTCCCCATCACGTGCCCCTGTCAAGGCTA
ATTAATTACGGCCGCAGTCGCATTCCCTGTGGTTCGCGTCCTCTCGAGCACCCTTGCCGCTTCACGATGGCCGCA
ACGCGTCAGCCGGCCACGGACCCCAAGCCATGCGCTCCGCTCGTGGACACATGATGGAGCGGACCGCGCTGGCGA
GGCTCCGAGCAGACGAGCAGGCTCAGCTTTGGCGACGAGCTCATGTGCAGAACTTTGGCAGCGCCTGGCTGAAGC
CGCCCGGCGTGCCCAAGACTCTCCACCAGATGCGAGAGGAGAAGCGCGAGCAGCAGGAGCATCAGGAGGCTGTTC
GCCGCGAACAACTCGCTCAGGAGCTGGCTGAGGCTGAGGCTGCCGGCTTACCTGACGACGGCATGATGGATGATG
TCCAGCTCGACGGCGCGCAGGACCTCGACAACCAAGTTCCCGATGCTGACGAAGAGTATGCCATGGACGAGGACG
AGGACGACGAGGACGACGAGCTCGATGAGGGCGACGTTGTTGTTGTTGATGACGACGACGGCCATAACGATCAAG
ACGAGATGGACGACGAAGCCGACGCTCAGAGGGAAGAAGACCGGCAGAACGACCTCGCGGCCGCCCGGATGCGAA
TGGCCGACGACGCCTTCCGAGAAGCCCTCGTCCGCGGAGACGCCGACACCGACGACATGTACGGCGCCGAAGACC
AAGCCACCGACCAGCAAGGACAAGACTACATGCTCGACGAAGACGACCTCGTCCACAGGCTCTCCACCGAAGACG
ACGCTCAGCCCCTCAACATGGACGCCGATCTCGACGATGACATCCCCGAAGCCGAGAGCGGCCGCTACGAGCACA
CCGACTCCGACGCCGGCGTCAGCTCCACCAGCGACGAAGATGATCAAGACGACGACCAAGACGACAGCCTCGTCC
ACGATCATCGCCTTCTTTCCGCCTCGAGGCAGGGCCCGCCTCAGTCCCCAACCATGCCCCGTCGAGGTACCCCCG
TCGCGCCACGGACAACCGACGTTGACCTCCTCCTTTCCCAGGACGGCAGCAGTCTCATCAGCAACGATGGCAGCC
CTGTGCTGAGCCGGAGGCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail