Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00482
Gene name
Locationscaffold_01:1982728..1989192
Strand-
Gene length (bp)6464
Transcript length (bp)6342
Coding sequence length (bp)6342
Protein length (aa) 2114

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00310 GATase_2 Glutamine amidotransferases class-II 4.4E-182 54 486
PF01645 Glu_synthase Conserved region in glutamate synthase 1.6E-153 869 1239
PF04898 Glu_syn_central Glutamate synthase central domain 6.4E-108 524 808
PF01493 GXGXG GXGXG motif 1.1E-85 1320 1506
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 6.9E-22 1751 2062
PF14691 Fer4_20 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster 1.2E-20 1628 1737
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 9.7E-09 1755 1788
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 2.2E-05 1752 1823
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.4E-06 1761 1788
PF03486 HI0933_like HI0933-like protein 1.8E-05 1752 1786

GO

GO Term Description Terminal node
GO:0006537 glutamate biosynthetic process Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0016491 oxidoreductase activity Yes
GO:0015930 glutamate synthase activity Yes
GO:0008152 metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6692 0.4179 0.0157 0.1761 0.4751 0.0426 0.0493 0.1645 0.1445 0.1274

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4048
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3257
Ophiocordyceps australis map64 (Brazil) OphauB2|1394
Ophiocordyceps camponoti-floridani Ophcf2|00482 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2057
Ophiocordyceps kimflemingae Ophio5|7088
Ophiocordyceps subramaniannii Hirsu2|8159

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00482
MGLLEDFDDRQVSIQAEQHPYQPYEYQTENNASWAGALPVKQGLYDPAYEKDACGVGFACHIKGKASHKIVSDAR
NLLCNMTHRGAVGSDARDGDGAGVMTSIPHWFFIKNFEREQDVKLPPPGQYAVGNLFFKPDDETFVESKRQLEDV
AESLGLRVLGWRRPPVDSTLLGPAAKSREPFIAQPFVVLADAYGPGNAPRSTDPASFDERLFERQLYVLRKRATH
TIGLKNWFYLCSLSNKNIVYKGQLAPVQVYSYYHDLVNADYEAHFALVHSRFSTNTFPSWDRAQPLRWAAHNGEI
NTLRGNKNWMRAREGVMQSDVFKDELEMMYPIVEESGSDSAAFDNVLELLTINGVLSLPEAVMLMVPEAWQGNEH
MDPHKAAFYEWAACQMEPWDGPALFTFADGRYCGANLDRNGLRPCRFYVMDDDRIICASEVGTIPVEPETVIYKG
RLQPGRMLLVDTQAGRIIDDKELKEAVASRHDFRAWLDRELIHMPAILEALDGSSVDLEAKPDAALLQEDPLLLA
FGYTFEQVSLLLAPMAADEKEALGSMGNDAPLACLTQAPRLLYDYFRQLFAQVTNPPIDPIRESIVMSLECYVGP
QGNLLEMDSSQCGRLMLPSPILSIPEFNAIVNVSSLYPKWTVKTIDLTFPKSQGVQGYLDHLDDICNEATAAIEA
RDRIIVLSDRRTSADRVAVSAVLASAMVHHHLVSNKWRSMAALVVETAEAREVHHMCVLLGYGTDAVNPYLAMEC
VLKLNREGLIKRKLSDEALIRNYKHSCDGGILKVMSKMGISTLASYKGAQIFEALGLDEEVVDRCFRGTASRIQG
LTFELIAEDAFRFHERGFPSRYTVGIQGLPESGEYHWRDGGEAHVNDPTSIANIQDAVRTKNDKSYEAYSRSEYE
QIKNCTLRGLLDFNFDHRTPVSIDQVEPWTEIVRRFCTGAMSYGSISMESHSTLAVAMNRLGGKSNTGEGGEDPE
RSQRLPNGDTMRSAIKQVASGRFGVTSAYLANSDELQIKMAQGAKPGEGGELPGHKVSKSIARTRHSTPGVGLIS
PPPHHDIYSIEDLKQLIYDLKCSSPRSRVSVKLVSEVGVGIVASGVAKAKADHILISGHDGGTGASRWTGIKYAG
LPWELGLAETHQTLVLNDLRGRVVVQTDGQLRTGRDIAIACLLGAEEWGFATAPLIALGCIVTRKCHLNTCPVGI
ATQDPELRKKFQGTPEHAINFFYYLANELRAIMAQLGFRTINEMVGHVEVLKVRDDLRTKKTANIDLSLLLTPAH
KLRPGVATFNVRKQDHKLYVRLDNKLISEAELTLDKGLPSRIECDIINTDRAMGTSLSYHISKRYGEAGLPLDTV
HVSIKGSAGQSFGAFLAPGVTLELEGDANDYVGKGLSGGRLIIYPPRAAVFKAEENILIGNVCLYGATSGTCFFR
GVAAERFAVRNSGATAVVEGVGDHGCEYMTGGRVVILGSTGRNFAAGMSGGIAYILDVQRDFDSKLNTEMVEAGP
LEDPAEIAYLRGLIEDHHHYTGSERAARILVDFTRALPRFVKVLPVDYKRVMEEEAAKAAAAKRAEYTLPVVSGP
KHKASADKVKMQDMEEAVGDKAAEKKRALVLDKTRGFMKYARRSEKYRSVNTRVKDWAELSSRLDEDELKYQSAR
CMDCGVPFCQSETGCPISNIIPKWNELVFQNQWRDALNRLLMTNNFPEFTGRVCPAPCEGACVLGINEDPVGIKS
IECAIIDRGFEMGWMVPQPPAMRTGKKVAIIGSGPAGLACADQLNRAGHSVTVYERADRLGGLLMYGIPNMKLDK
RVVKRRTDFMAAEGVDFRTGVSVGEPGQPSLTDLRANHDAVVIATGATVARDLAIKGRELEGIHLAMEFLHKNTK
SLLDSELADEAYISAKDKHVVVIGGGDTGNDCIGTSVRHGATSVTNFELLPQPPPERASDNPWPQWPRIYRVDYG
HSEVRQHTGKDPREYCIMSEEFIGDGEGRVKGIKTMRVEWTKSPSGGWDMKKVDGSQQFFPADLVLLAMGFLGPE
SRALGDEIEKDGRKNVKTPPGRYCTNLEGVFAAGDARRGQSLIVWGINEGRMAAREVDLYLEKCTSLPVTGGIVK
RTAQEILARIETH*
Coding >Ophcf2|00482
ATGGGCCTGCTTGAGGATTTCGACGACCGACAAGTCTCCATTCAAGCTGAACAGCACCCCTACCAACCCTATGAG
TACCAGACCGAGAACAACGCCTCTTGGGCGGGGGCCCTACCGGTGAAGCAGGGACTCTACGACCCGGCCTACGAG
AAAGATGCCTGCGGTGTCGGCTTCGCCTGCCATATCAAGGGCAAGGCCAGCCACAAAATCGTCAGTGATGCGCGC
AATCTTTTGTGCAACATGACCCATCGGGGAGCTGTTGGCTCCGATGCTCGTGACGGCGACGGCGCTGGCGTCATG
ACGTCGATCCCTCATTGGTTCTTCATCAAGAACTTTGAGAGGGAGCAGGACGTCAAGCTTCCACCTCCCGGCCAG
TACGCCGTCGGGAACCTCTTCTTCAAGCCCGACGACGAGACATTTGTCGAGTCCAAGAGGCAGCTGGAGGACGTT
GCCGAGTCGCTGGGCCTGCGCGTCCTCGGCTGGCGTCGCCCTCCTGTCGACTCGACTCTGCTGGGCCCGGCCGCC
AAGTCCCGCGAGCCCTTCATCGCTCAGCCCTTTGTCGTCCTCGCCGACGCCTACGGCCCCGGCAATGCGCCCCGG
TCGACGGACCCGGCCAGCTTTGACGAGCGCCTCTTCGAGCGTCAGCTCTACGTGCTGCGCAAACGCGCCACACAC
ACCATCGGCCTCAAGAACTGGTTCTACCTGTGCTCGCTCTCCAACAAGAATATCGTCTACAAGGGACAGCTTGCC
CCCGTGCAGGTCTATTCTTACTATCACGATCTGGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCC
CGATTCTCGACCAACACGTTCCCTTCGTGGGATCGCGCCCAGCCTCTGCGCTGGGCCGCTCACAATGGCGAGATC
AACACGCTGCGTGGCAACAAGAATTGGATGCGCGCTCGCGAGGGCGTCATGCAGTCTGACGTCTTCAAGGATGAA
TTGGAGATGATGTATCCCATTGTCGAGGAGAGCGGCTCCGACTCGGCCGCCTTCGACAACGTGCTCGAGCTCCTG
ACCATCAACGGCGTCCTGTCTCTGCCCGAGGCCGTCATGCTCATGGTCCCCGAGGCCTGGCAGGGCAACGAGCAC
ATGGACCCTCACAAGGCCGCCTTTTACGAATGGGCTGCCTGCCAGATGGAGCCGTGGGACGGTCCGGCCCTCTTC
ACCTTTGCCGACGGCCGCTACTGCGGTGCCAACCTGGATCGCAACGGGCTGCGGCCCTGCCGATTCTACGTCATG
GACGACGATCGCATCATCTGCGCCTCCGAGGTCGGCACCATTCCCGTCGAGCCCGAGACGGTCATCTACAAGGGC
CGCTTGCAGCCCGGACGCATGCTCCTCGTTGACACCCAGGCTGGTCGCATCATCGACGATAAGGAGCTCAAGGAG
GCCGTGGCGAGCCGCCACGACTTCCGTGCCTGGCTTGATCGCGAGCTCATCCACATGCCCGCCATCCTCGAGGCG
CTTGACGGTTCTTCGGTCGACCTCGAGGCTAAGCCCGATGCCGCCCTTCTTCAGGAAGACCCGCTGCTCCTGGCC
TTCGGGTACACCTTTGAGCAGGTCAGCCTGTTGCTGGCCCCGATGGCCGCCGACGAAAAGGAGGCGCTCGGCTCC
ATGGGTAACGATGCTCCCCTGGCTTGCTTGACGCAGGCACCGCGTCTGCTGTACGATTATTTCCGCCAGCTATTT
GCCCAGGTCACGAACCCGCCCATCGATCCGATCCGTGAGTCCATCGTCATGTCGTTGGAGTGCTACGTCGGACCG
CAGGGCAACCTGCTCGAGATGGACTCCTCCCAGTGTGGCCGTCTCATGCTGCCCAGTCCCATTCTGTCGATTCCC
GAGTTCAACGCTATCGTCAACGTGTCATCCCTCTATCCCAAGTGGACCGTCAAGACCATTGACCTTACCTTTCCC
AAGTCCCAGGGGGTGCAGGGCTACCTTGACCACCTCGATGACATCTGCAACGAGGCTACGGCGGCCATCGAGGCC
CGGGATCGCATCATTGTCCTGTCCGACCGCCGCACCTCGGCCGACCGCGTGGCCGTCTCGGCCGTTCTCGCTTCT
GCCATGGTCCATCACCACCTCGTCAGTAACAAATGGCGATCCATGGCGGCCCTCGTCGTCGAGACGGCCGAGGCC
CGCGAGGTCCACCACATGTGCGTGTTATTGGGCTATGGTACCGACGCTGTCAACCCCTACCTCGCCATGGAGTGC
GTCCTGAAGCTCAATCGAGAGGGCCTGATCAAGCGGAAGCTTTCGGACGAGGCCCTCATCCGCAACTACAAGCAT
TCGTGCGACGGCGGCATTCTCAAGGTCATGAGCAAGATGGGCATCTCCACCCTCGCCTCATACAAGGGAGCGCAG
ATCTTCGAGGCCCTCGGCCTGGACGAGGAGGTCGTTGATCGATGCTTCAGGGGCACGGCCTCGCGCATCCAGGGC
CTCACCTTCGAGCTCATTGCCGAGGATGCTTTCCGCTTCCACGAGCGCGGCTTTCCCTCGCGGTACACCGTTGGC
ATCCAGGGCCTGCCCGAGTCGGGCGAATATCATTGGCGCGACGGAGGTGAGGCTCACGTCAACGATCCGACGTCC
ATCGCCAATATCCAAGACGCTGTCCGCACCAAGAACGACAAGTCTTACGAGGCATACTCGCGGTCCGAGTACGAG
CAGATCAAGAACTGCACGCTGCGTGGACTCCTCGACTTCAACTTTGATCACCGCACTCCCGTGTCCATCGATCAG
GTCGAGCCGTGGACCGAGATTGTGCGCCGCTTCTGCACGGGCGCCATGTCCTACGGCTCTATCTCTATGGAGTCC
CACTCGACGCTGGCCGTCGCCATGAACCGGCTGGGTGGCAAGTCGAACACCGGCGAGGGCGGAGAGGATCCCGAG
CGGTCACAGCGCTTGCCCAACGGCGACACGATGCGATCTGCCATCAAGCAGGTGGCCTCGGGCCGCTTCGGTGTC
ACGTCGGCTTACTTGGCCAACTCGGACGAGCTGCAGATCAAGATGGCTCAGGGCGCGAAGCCCGGCGAGGGCGGC
GAACTCCCCGGCCACAAGGTGTCCAAGTCGATTGCGCGGACGCGACACTCGACTCCGGGCGTGGGCCTGATCTCA
CCGCCGCCGCATCACGACATCTACTCCATCGAGGATCTCAAGCAGCTCATCTACGACCTCAAGTGCTCGAGCCCC
CGTTCGCGAGTCTCGGTCAAGCTGGTGTCCGAGGTGGGCGTCGGCATCGTGGCCTCGGGCGTCGCCAAGGCCAAG
GCCGATCATATCCTCATTTCCGGTCACGACGGCGGCACCGGTGCCTCGCGCTGGACGGGCATCAAGTACGCCGGC
CTGCCCTGGGAGCTCGGTCTCGCCGAGACGCACCAGACGCTGGTCCTCAACGACTTGCGCGGCCGTGTCGTGGTG
CAGACGGATGGCCAGCTTAGGACCGGGCGAGACATCGCCATCGCCTGCCTGCTCGGCGCAGAGGAATGGGGCTTC
GCCACGGCTCCCCTGATTGCCCTGGGTTGCATCGTCACCCGCAAGTGCCATCTCAACACGTGCCCCGTCGGCATC
GCGACGCAGGACCCCGAGCTGCGCAAGAAGTTTCAGGGGACGCCCGAGCACGCCATCAACTTCTTCTACTACCTC
GCCAACGAGCTCCGCGCCATCATGGCTCAGCTCGGCTTCCGTACCATCAACGAGATGGTCGGCCACGTCGAGGTG
CTCAAGGTCCGCGACGACCTGAGGACCAAGAAGACGGCCAACATTGACCTATCGCTGCTCCTCACCCCGGCCCAT
AAGCTTCGGCCTGGGGTGGCTACGTTCAACGTCCGGAAGCAGGACCACAAGCTCTACGTCCGACTCGACAACAAG
CTCATCTCCGAGGCGGAGCTTACGCTCGACAAGGGCCTGCCGTCGAGGATCGAGTGCGACATCATCAATACCGAT
CGGGCCATGGGCACCTCGCTATCGTATCACATCTCGAAGCGTTACGGCGAGGCTGGCCTTCCGCTCGACACGGTC
CACGTGAGCATCAAGGGATCGGCTGGGCAGTCCTTCGGCGCCTTCCTGGCCCCCGGTGTGACGCTGGAATTGGAG
GGAGACGCCAACGACTACGTCGGCAAGGGCCTATCTGGTGGGCGGCTGATCATCTACCCGCCGCGCGCCGCCGTC
TTCAAGGCCGAGGAGAACATCCTGATCGGTAACGTGTGCCTCTATGGCGCCACGAGCGGGACGTGTTTCTTCCGC
GGCGTCGCGGCCGAGCGCTTCGCTGTCCGCAACTCGGGCGCCACGGCCGTCGTCGAGGGCGTCGGCGATCACGGC
TGCGAGTATATGACAGGCGGCCGTGTCGTCATCCTCGGCAGCACAGGTCGGAACTTTGCGGCCGGCATGTCGGGC
GGCATCGCCTACATCCTCGACGTCCAACGCGACTTTGACTCGAAGCTCAACACGGAGATGGTTGAGGCCGGACCG
CTCGAGGATCCGGCCGAGATCGCCTACCTGCGCGGGCTCATCGAGGACCATCATCACTACACGGGGTCGGAGCGG
GCGGCACGCATCCTGGTCGACTTTACGCGGGCGCTCCCTCGCTTCGTCAAAGTGCTGCCGGTCGACTACAAGCGC
GTGATGGAGGAGGAGGCGGCCAAGGCGGCGGCGGCCAAGCGCGCCGAATACACGCTGCCGGTCGTGTCCGGACCC
AAGCACAAGGCCTCGGCGGACAAGGTCAAGATGCAGGACATGGAAGAGGCCGTCGGCGACAAGGCGGCGGAGAAG
AAGCGGGCGCTGGTGCTGGACAAGACTCGAGGCTTCATGAAGTACGCTCGAAGGTCGGAGAAGTACAGGTCCGTC
AACACGCGCGTCAAGGACTGGGCCGAGCTCAGCTCGCGGCTGGACGAGGATGAGCTCAAGTACCAGTCGGCGCGC
TGCATGGACTGCGGTGTGCCGTTTTGCCAGTCGGAGACGGGCTGCCCCATCTCCAACATCATCCCCAAGTGGAAC
GAGCTGGTGTTCCAGAACCAGTGGAGGGACGCGCTCAACCGGCTGCTCATGACCAACAACTTCCCCGAGTTCACG
GGCCGCGTGTGTCCGGCGCCGTGCGAAGGCGCCTGCGTGCTGGGCATCAACGAGGATCCGGTGGGCATCAAGTCG
ATCGAGTGCGCCATCATCGACCGCGGCTTCGAGATGGGCTGGATGGTGCCGCAGCCGCCGGCGATGCGGACGGGC
AAGAAGGTGGCCATCATCGGCTCCGGGCCGGCCGGGCTGGCGTGCGCCGACCAGCTCAACCGGGCCGGTCACAGC
GTGACGGTGTATGAGCGGGCTGACCGGCTGGGCGGGCTGCTCATGTACGGCATTCCCAACATGAAGCTGGACAAG
CGCGTGGTCAAGCGACGAACCGACTTCATGGCGGCCGAGGGCGTCGACTTCCGGACGGGCGTCTCGGTCGGCGAG
CCGGGACAGCCGAGCCTGACGGATCTCCGGGCCAACCACGATGCCGTTGTCATCGCCACGGGCGCGACGGTGGCG
CGCGACCTGGCAATCAAGGGTCGCGAGCTGGAGGGCATCCACCTGGCCATGGAGTTCTTGCACAAGAACACCAAG
TCGCTGCTGGATTCGGAGCTGGCGGATGAGGCCTACATCTCGGCCAAGGACAAGCACGTCGTCGTCATCGGCGGA
GGCGACACGGGCAACGACTGCATCGGCACGTCGGTGCGGCACGGGGCGACGTCGGTGACCAACTTTGAGCTGCTC
CCGCAGCCTCCGCCAGAGCGGGCGAGCGACAATCCTTGGCCGCAGTGGCCTCGCATCTACCGCGTCGACTACGGG
CACAGCGAGGTGCGGCAGCATACGGGCAAGGACCCGCGTGAGTACTGCATCATGTCGGAGGAGTTCATCGGCGAT
GGCGAGGGACGGGTCAAGGGCATCAAGACGATGCGCGTCGAGTGGACCAAGTCTCCGAGCGGTGGATGGGACATG
AAGAAGGTGGACGGATCGCAGCAGTTCTTCCCGGCCGACCTGGTGCTGCTGGCCATGGGTTTCCTCGGGCCCGAG
TCGCGGGCGCTGGGCGACGAGATTGAGAAGGACGGCCGCAAGAACGTCAAGACGCCGCCGGGGCGATACTGCACC
AACTTGGAGGGCGTATTCGCTGCCGGAGACGCGCGTCGCGGACAGTCGCTGATTGTGTGGGGAATCAATGAAGGG
CGGATGGCAGCGCGCGAGGTGGATCTGTATCTCGAAAAGTGCACCAGCCTTCCGGTGACGGGCGGCATCGTGAAG
CGGACGGCGCAGGAGATTCTGGCGAGGATCGAGACTCATTGA
Transcript >Ophcf2|00482
ATGGGCCTGCTTGAGGATTTCGACGACCGACAAGTCTCCATTCAAGCTGAACAGCACCCCTACCAACCCTATGAG
TACCAGACCGAGAACAACGCCTCTTGGGCGGGGGCCCTACCGGTGAAGCAGGGACTCTACGACCCGGCCTACGAG
AAAGATGCCTGCGGTGTCGGCTTCGCCTGCCATATCAAGGGCAAGGCCAGCCACAAAATCGTCAGTGATGCGCGC
AATCTTTTGTGCAACATGACCCATCGGGGAGCTGTTGGCTCCGATGCTCGTGACGGCGACGGCGCTGGCGTCATG
ACGTCGATCCCTCATTGGTTCTTCATCAAGAACTTTGAGAGGGAGCAGGACGTCAAGCTTCCACCTCCCGGCCAG
TACGCCGTCGGGAACCTCTTCTTCAAGCCCGACGACGAGACATTTGTCGAGTCCAAGAGGCAGCTGGAGGACGTT
GCCGAGTCGCTGGGCCTGCGCGTCCTCGGCTGGCGTCGCCCTCCTGTCGACTCGACTCTGCTGGGCCCGGCCGCC
AAGTCCCGCGAGCCCTTCATCGCTCAGCCCTTTGTCGTCCTCGCCGACGCCTACGGCCCCGGCAATGCGCCCCGG
TCGACGGACCCGGCCAGCTTTGACGAGCGCCTCTTCGAGCGTCAGCTCTACGTGCTGCGCAAACGCGCCACACAC
ACCATCGGCCTCAAGAACTGGTTCTACCTGTGCTCGCTCTCCAACAAGAATATCGTCTACAAGGGACAGCTTGCC
CCCGTGCAGGTCTATTCTTACTATCACGATCTGGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCC
CGATTCTCGACCAACACGTTCCCTTCGTGGGATCGCGCCCAGCCTCTGCGCTGGGCCGCTCACAATGGCGAGATC
AACACGCTGCGTGGCAACAAGAATTGGATGCGCGCTCGCGAGGGCGTCATGCAGTCTGACGTCTTCAAGGATGAA
TTGGAGATGATGTATCCCATTGTCGAGGAGAGCGGCTCCGACTCGGCCGCCTTCGACAACGTGCTCGAGCTCCTG
ACCATCAACGGCGTCCTGTCTCTGCCCGAGGCCGTCATGCTCATGGTCCCCGAGGCCTGGCAGGGCAACGAGCAC
ATGGACCCTCACAAGGCCGCCTTTTACGAATGGGCTGCCTGCCAGATGGAGCCGTGGGACGGTCCGGCCCTCTTC
ACCTTTGCCGACGGCCGCTACTGCGGTGCCAACCTGGATCGCAACGGGCTGCGGCCCTGCCGATTCTACGTCATG
GACGACGATCGCATCATCTGCGCCTCCGAGGTCGGCACCATTCCCGTCGAGCCCGAGACGGTCATCTACAAGGGC
CGCTTGCAGCCCGGACGCATGCTCCTCGTTGACACCCAGGCTGGTCGCATCATCGACGATAAGGAGCTCAAGGAG
GCCGTGGCGAGCCGCCACGACTTCCGTGCCTGGCTTGATCGCGAGCTCATCCACATGCCCGCCATCCTCGAGGCG
CTTGACGGTTCTTCGGTCGACCTCGAGGCTAAGCCCGATGCCGCCCTTCTTCAGGAAGACCCGCTGCTCCTGGCC
TTCGGGTACACCTTTGAGCAGGTCAGCCTGTTGCTGGCCCCGATGGCCGCCGACGAAAAGGAGGCGCTCGGCTCC
ATGGGTAACGATGCTCCCCTGGCTTGCTTGACGCAGGCACCGCGTCTGCTGTACGATTATTTCCGCCAGCTATTT
GCCCAGGTCACGAACCCGCCCATCGATCCGATCCGTGAGTCCATCGTCATGTCGTTGGAGTGCTACGTCGGACCG
CAGGGCAACCTGCTCGAGATGGACTCCTCCCAGTGTGGCCGTCTCATGCTGCCCAGTCCCATTCTGTCGATTCCC
GAGTTCAACGCTATCGTCAACGTGTCATCCCTCTATCCCAAGTGGACCGTCAAGACCATTGACCTTACCTTTCCC
AAGTCCCAGGGGGTGCAGGGCTACCTTGACCACCTCGATGACATCTGCAACGAGGCTACGGCGGCCATCGAGGCC
CGGGATCGCATCATTGTCCTGTCCGACCGCCGCACCTCGGCCGACCGCGTGGCCGTCTCGGCCGTTCTCGCTTCT
GCCATGGTCCATCACCACCTCGTCAGTAACAAATGGCGATCCATGGCGGCCCTCGTCGTCGAGACGGCCGAGGCC
CGCGAGGTCCACCACATGTGCGTGTTATTGGGCTATGGTACCGACGCTGTCAACCCCTACCTCGCCATGGAGTGC
GTCCTGAAGCTCAATCGAGAGGGCCTGATCAAGCGGAAGCTTTCGGACGAGGCCCTCATCCGCAACTACAAGCAT
TCGTGCGACGGCGGCATTCTCAAGGTCATGAGCAAGATGGGCATCTCCACCCTCGCCTCATACAAGGGAGCGCAG
ATCTTCGAGGCCCTCGGCCTGGACGAGGAGGTCGTTGATCGATGCTTCAGGGGCACGGCCTCGCGCATCCAGGGC
CTCACCTTCGAGCTCATTGCCGAGGATGCTTTCCGCTTCCACGAGCGCGGCTTTCCCTCGCGGTACACCGTTGGC
ATCCAGGGCCTGCCCGAGTCGGGCGAATATCATTGGCGCGACGGAGGTGAGGCTCACGTCAACGATCCGACGTCC
ATCGCCAATATCCAAGACGCTGTCCGCACCAAGAACGACAAGTCTTACGAGGCATACTCGCGGTCCGAGTACGAG
CAGATCAAGAACTGCACGCTGCGTGGACTCCTCGACTTCAACTTTGATCACCGCACTCCCGTGTCCATCGATCAG
GTCGAGCCGTGGACCGAGATTGTGCGCCGCTTCTGCACGGGCGCCATGTCCTACGGCTCTATCTCTATGGAGTCC
CACTCGACGCTGGCCGTCGCCATGAACCGGCTGGGTGGCAAGTCGAACACCGGCGAGGGCGGAGAGGATCCCGAG
CGGTCACAGCGCTTGCCCAACGGCGACACGATGCGATCTGCCATCAAGCAGGTGGCCTCGGGCCGCTTCGGTGTC
ACGTCGGCTTACTTGGCCAACTCGGACGAGCTGCAGATCAAGATGGCTCAGGGCGCGAAGCCCGGCGAGGGCGGC
GAACTCCCCGGCCACAAGGTGTCCAAGTCGATTGCGCGGACGCGACACTCGACTCCGGGCGTGGGCCTGATCTCA
CCGCCGCCGCATCACGACATCTACTCCATCGAGGATCTCAAGCAGCTCATCTACGACCTCAAGTGCTCGAGCCCC
CGTTCGCGAGTCTCGGTCAAGCTGGTGTCCGAGGTGGGCGTCGGCATCGTGGCCTCGGGCGTCGCCAAGGCCAAG
GCCGATCATATCCTCATTTCCGGTCACGACGGCGGCACCGGTGCCTCGCGCTGGACGGGCATCAAGTACGCCGGC
CTGCCCTGGGAGCTCGGTCTCGCCGAGACGCACCAGACGCTGGTCCTCAACGACTTGCGCGGCCGTGTCGTGGTG
CAGACGGATGGCCAGCTTAGGACCGGGCGAGACATCGCCATCGCCTGCCTGCTCGGCGCAGAGGAATGGGGCTTC
GCCACGGCTCCCCTGATTGCCCTGGGTTGCATCGTCACCCGCAAGTGCCATCTCAACACGTGCCCCGTCGGCATC
GCGACGCAGGACCCCGAGCTGCGCAAGAAGTTTCAGGGGACGCCCGAGCACGCCATCAACTTCTTCTACTACCTC
GCCAACGAGCTCCGCGCCATCATGGCTCAGCTCGGCTTCCGTACCATCAACGAGATGGTCGGCCACGTCGAGGTG
CTCAAGGTCCGCGACGACCTGAGGACCAAGAAGACGGCCAACATTGACCTATCGCTGCTCCTCACCCCGGCCCAT
AAGCTTCGGCCTGGGGTGGCTACGTTCAACGTCCGGAAGCAGGACCACAAGCTCTACGTCCGACTCGACAACAAG
CTCATCTCCGAGGCGGAGCTTACGCTCGACAAGGGCCTGCCGTCGAGGATCGAGTGCGACATCATCAATACCGAT
CGGGCCATGGGCACCTCGCTATCGTATCACATCTCGAAGCGTTACGGCGAGGCTGGCCTTCCGCTCGACACGGTC
CACGTGAGCATCAAGGGATCGGCTGGGCAGTCCTTCGGCGCCTTCCTGGCCCCCGGTGTGACGCTGGAATTGGAG
GGAGACGCCAACGACTACGTCGGCAAGGGCCTATCTGGTGGGCGGCTGATCATCTACCCGCCGCGCGCCGCCGTC
TTCAAGGCCGAGGAGAACATCCTGATCGGTAACGTGTGCCTCTATGGCGCCACGAGCGGGACGTGTTTCTTCCGC
GGCGTCGCGGCCGAGCGCTTCGCTGTCCGCAACTCGGGCGCCACGGCCGTCGTCGAGGGCGTCGGCGATCACGGC
TGCGAGTATATGACAGGCGGCCGTGTCGTCATCCTCGGCAGCACAGGTCGGAACTTTGCGGCCGGCATGTCGGGC
GGCATCGCCTACATCCTCGACGTCCAACGCGACTTTGACTCGAAGCTCAACACGGAGATGGTTGAGGCCGGACCG
CTCGAGGATCCGGCCGAGATCGCCTACCTGCGCGGGCTCATCGAGGACCATCATCACTACACGGGGTCGGAGCGG
GCGGCACGCATCCTGGTCGACTTTACGCGGGCGCTCCCTCGCTTCGTCAAAGTGCTGCCGGTCGACTACAAGCGC
GTGATGGAGGAGGAGGCGGCCAAGGCGGCGGCGGCCAAGCGCGCCGAATACACGCTGCCGGTCGTGTCCGGACCC
AAGCACAAGGCCTCGGCGGACAAGGTCAAGATGCAGGACATGGAAGAGGCCGTCGGCGACAAGGCGGCGGAGAAG
AAGCGGGCGCTGGTGCTGGACAAGACTCGAGGCTTCATGAAGTACGCTCGAAGGTCGGAGAAGTACAGGTCCGTC
AACACGCGCGTCAAGGACTGGGCCGAGCTCAGCTCGCGGCTGGACGAGGATGAGCTCAAGTACCAGTCGGCGCGC
TGCATGGACTGCGGTGTGCCGTTTTGCCAGTCGGAGACGGGCTGCCCCATCTCCAACATCATCCCCAAGTGGAAC
GAGCTGGTGTTCCAGAACCAGTGGAGGGACGCGCTCAACCGGCTGCTCATGACCAACAACTTCCCCGAGTTCACG
GGCCGCGTGTGTCCGGCGCCGTGCGAAGGCGCCTGCGTGCTGGGCATCAACGAGGATCCGGTGGGCATCAAGTCG
ATCGAGTGCGCCATCATCGACCGCGGCTTCGAGATGGGCTGGATGGTGCCGCAGCCGCCGGCGATGCGGACGGGC
AAGAAGGTGGCCATCATCGGCTCCGGGCCGGCCGGGCTGGCGTGCGCCGACCAGCTCAACCGGGCCGGTCACAGC
GTGACGGTGTATGAGCGGGCTGACCGGCTGGGCGGGCTGCTCATGTACGGCATTCCCAACATGAAGCTGGACAAG
CGCGTGGTCAAGCGACGAACCGACTTCATGGCGGCCGAGGGCGTCGACTTCCGGACGGGCGTCTCGGTCGGCGAG
CCGGGACAGCCGAGCCTGACGGATCTCCGGGCCAACCACGATGCCGTTGTCATCGCCACGGGCGCGACGGTGGCG
CGCGACCTGGCAATCAAGGGTCGCGAGCTGGAGGGCATCCACCTGGCCATGGAGTTCTTGCACAAGAACACCAAG
TCGCTGCTGGATTCGGAGCTGGCGGATGAGGCCTACATCTCGGCCAAGGACAAGCACGTCGTCGTCATCGGCGGA
GGCGACACGGGCAACGACTGCATCGGCACGTCGGTGCGGCACGGGGCGACGTCGGTGACCAACTTTGAGCTGCTC
CCGCAGCCTCCGCCAGAGCGGGCGAGCGACAATCCTTGGCCGCAGTGGCCTCGCATCTACCGCGTCGACTACGGG
CACAGCGAGGTGCGGCAGCATACGGGCAAGGACCCGCGTGAGTACTGCATCATGTCGGAGGAGTTCATCGGCGAT
GGCGAGGGACGGGTCAAGGGCATCAAGACGATGCGCGTCGAGTGGACCAAGTCTCCGAGCGGTGGATGGGACATG
AAGAAGGTGGACGGATCGCAGCAGTTCTTCCCGGCCGACCTGGTGCTGCTGGCCATGGGTTTCCTCGGGCCCGAG
TCGCGGGCGCTGGGCGACGAGATTGAGAAGGACGGCCGCAAGAACGTCAAGACGCCGCCGGGGCGATACTGCACC
AACTTGGAGGGCGTATTCGCTGCCGGAGACGCGCGTCGCGGACAGTCGCTGATTGTGTGGGGAATCAATGAAGGG
CGGATGGCAGCGCGCGAGGTGGATCTGTATCTCGAAAAGTGCACCAGCCTTCCGGTGACGGGCGGCATCGTGAAG
CGGACGGCGCAGGAGATTCTGGCGAGGATCGAGACTCATTGA
Gene >Ophcf2|00482
ATGGGCCTGCTTGAGGATTTCGACGACCGACAAGTCTCCATTCAAGCTGAACAGCACCCCTACCAACCCTATGAG
TACCAGACCGAGAACAACGCCTCTTGGGCGGGGGCCCTACCGGTGAAGCAGGGACTCTACGACCCGGCCTACGAG
AAAGATGCCTGCGGTGTCGGCTTCGCCTGGTGAGTCCTTCTTGTCCTCTCTCTCACCCTCTGGCCTTTGGAATCG
CTAACTCGCAGGTAAAGCCATATCAAGGGCAAGGCCAGCCACAAAATCGTCAGTGATGCGCGCAATCTTTTGTGC
AACATGACCCATCGGGGAGCTGTTGGCTCCGATGCTCGTGACGGCGACGGCGCTGGCGTCATGACGTCGATCCCT
CATTGGTTCTTCATCAAGAACTTTGAGAGGGAGCAGGACGTCAAGCTTCCACCTCCCGGCCAGTACGCCGTCGGG
AACCTCTTCTTCAAGCCCGACGACGAGACATTTGTCGAGTCCAAGAGGCAGCTGGAGGACGTTGCCGAGTCGCTG
GGCCTGCGCGTCCTCGGCTGGCGTCGCCCTCCTGTCGACTCGACTCTGCTGGGCCCGGCCGCCAAGTCCCGCGAG
CCCTTCATCGCTCAGCCCTTTGTCGTCCTCGCCGACGCCTACGGCCCCGGCAATGCGCCCCGGTCGACGGACCCG
GCCAGCTTTGACGAGCGCCTCTTCGAGCGTCAGCTCTACGTGCTGCGCAAACGCGCCACACACACCATCGGCCTC
AAGAACTGGTTCTACCTGTGCTCGCTCTCCAACAAGAATATCGTCTACAAGGGACAGCTTGCCCCCGTGCAGGTC
TATTCTTACTATCACGATCTGGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCCCGATTCTCGACC
AACACGTTCCCTTCGTGGGATCGCGCCCAGCCTCTGCGCTGGGCCGCTCACAATGGCGAGATCAACACGCTGCGT
GGCAACAAGAATTGGATGCGCGCTCGCGAGGGCGTCATGCAGTCTGACGTCTTCAAGGATGAATTGGAGATGATG
TATCCCATTGTCGAGGAGAGCGGCTCCGACTCGGCCGCCTTCGACAACGTGCTCGAGCTCCTGACCATCAACGGC
GTCCTGTCTCTGCCCGAGGCCGTCATGCTCATGGTCCCCGAGGCCTGGCAGGGCAACGAGCACATGGACCCTCAC
AAGGCCGCCTTTTACGAATGGGCTGCCTGCCAGATGGAGCCGTGGGACGGTCCGGCCCTCTTCACCTTTGCCGAC
GGCCGCTACTGCGGTGCCAACCTGGATCGCAACGGGCTGCGGCCCTGCCGATTCTACGTCATGGACGACGATCGC
ATCATCTGCGCCTCCGAGGTCGGCACCATTCCCGTCGAGCCCGAGACGGTCATCTACAAGGGCCGCTTGCAGCCC
GGACGCATGCTCCTCGTTGACACCCAGGCTGGTCGCATCATCGACGATAAGGAGCTCAAGGAGGCCGTGGCGAGC
CGCCACGACTTCCGTGCCTGGCTTGATCGCGAGCTCATCCACATGCCCGCCATCCTCGAGGCGCTTGACGGTTCT
TCGGTCGACCTCGAGGCTAAGCCCGATGCCGCCCTTCTTCAGGAAGACCCGCTGCTCCTGGCCTTCGGGTACACC
TTTGAGCAGGTCAGCCTGTTGCTGGCCCCGATGGCCGCCGACGAAAAGGAGGCGCTCGGCTCCATGGGTAACGAT
GCTCCCCTGGCTTGCTTGACGCAGGCACCGCGTCTGCTGTACGATTATTTCCGCCAGCTATTTGCCCAGGTCACG
AACCCGCCCATCGATCCGATCCGTGAGTCCATCGTCATGTCGTTGGAGTGCTACGTCGGACCGCAGGGCAACCTG
CTCGAGATGGACTCCTCCCAGTGTGGCCGTCTCATGCTGCCCAGTCCCATTCTGTCGATTCCCGAGTTCAACGCT
ATCGTCAACGTGTCATCCCTCTATCCCAAGTGGACCGTCAAGACCATTGACCTTACCTTTCCCAAGTCCCAGGGG
GTGCAGGGCTACCTTGACCACCTCGATGACATCTGCAACGAGGCTACGGCGGCCATCGAGGCCCGGGATCGCATC
ATTGTCCTGTCCGACCGCCGCACCTCGGCCGACCGCGTGGCCGTCTCGGCCGTTCTCGCTTCTGCCATGGTCCAT
CACCACCTCGTCAGTAACAAATGGCGATCCATGGCGGCCCTCGTCGTCGAGACGGCCGAGGCCCGCGAGGTCCAC
CACATGTGCGTGTTATTGGGCTATGGTACCGACGCTGTCAACCCCTACCTCGCCATGGAGTGCGTCCTGAAGCTC
AATCGAGAGGGCCTGATCAAGCGGAAGCTTTCGGACGAGGCCCTCATCCGCAACTACAAGCATTCGTGCGACGGC
GGCATTCTCAAGGTCATGAGCAAGATGGGCATCTCCACCCTCGCCTCATACAAGGGAGCGCAGATCTTCGAGGCC
CTCGGCCTGGACGAGGAGGTCGTTGATCGATGCTTCAGGGGCACGGCCTCGCGCATCCAGGGCCTCACCTTCGAG
CTCATTGCCGAGGATGCTTTCCGCTTCCACGAGCGCGGCTTTCCCTCGCGGTACACCGTTGGCATCCAGGGCCTG
CCCGAGTCGGGCGAATATCATTGGCGCGACGGAGGTGAGGCTCACGTCAACGATCCGACGTCCATCGCCAATATC
CAAGACGCTGTCCGCACCAAGAACGACAAGTCTTACGAGGCATACTCGCGGTCCGAGTACGAGCAGATCAAGAAC
TGCACGCTGCGTGGACTCCTCGACTTCAACTTTGATCACCGCACTCCCGTGTCCATCGATCAGGTCGAGCCGTGG
ACCGAGATTGTGCGCCGCTTCTGCACGGGCGCCATGTCCTACGGCTCTATCTCTATGGAGTCCCACTCGACGCTG
GCCGTCGCCATGAACCGGCTGGGTGGCAAGTCGAACACCGGCGAGGGCGGAGAGGATCCCGAGCGGTCACAGCGC
TTGCCCAACGGCGACACGATGCGATCTGCCATCAAGCAGGTGGCCTCGGGCCGCTTCGGTGTCACGTCGGCTTAC
TTGGCCAACTCGGACGAGCTGCAGATCAAGATGGCTCAGGGCGCGAAGCCCGGCGAGGGCGGCGAACTCCCCGGC
CACAAGGTGTCCAAGTCGATTGCGCGGACGCGACACTCGACTCCGGGCGTGGGCCTGATCTCACCGCCGCCGCAT
CACGACATCTACTCCATCGAGGATCTCAAGCAGCTCATCTACGACCTCAAGTGCTCGAGCCCCCGTTCGCGAGTC
TCGGTCAAGCTGGTGTCCGAGGTGGGCGTCGGCATCGTGGCCTCGGGCGTCGCCAAGGCCAAGGCCGATCATATC
CTCATTTCCGGTCACGACGGCGGCACCGGTGCCTCGCGCTGGACGGGCATCAAGTACGCCGGCCTGCCCTGGGAG
CTCGGTCTCGCCGAGACGCACCAGACGCTGGTCCTCAACGACTTGCGCGGCCGTGTCGTGGTGCAGACGGATGGC
CAGCTTAGGACCGGGCGAGACATCGCCATCGCCTGCCTGCTCGGCGCAGAGGAATGGGGCTTCGCCACGGCTCCC
CTGATTGCCCTGGGTTGCATCGTCACCCGCAAGTGCCATCTCAACACGTGCCCCGTCGGCATCGCGACGCAGGAC
CCCGAGCTGCGCAAGAAGTTTCAGGGGACGCCCGAGCACGCCATCAACTTCTTCTACTACCTCGCCAACGAGCTC
CGCGCCATCATGGCTCAGCTCGGCTTCCGTACCATCAACGAGATGGTCGGCCACGTCGAGGTGCTCAAGGTCCGC
GACGACCTGAGGACCAAGAAGACGGCCAACATTGACCTATCGCTGCTCCTCACCCCGGCCCATAAGCTTCGGCCT
GGGGTGGCTACGTTCAACGTCCGGAAGCAGGACCACAAGCTCTACGTCCGACTCGACAACAAGCTCATCTCCGAG
GCGGAGCTTACGCTCGACAAGGGCCTGCCGTCGAGGATCGAGTGCGACATCATCAATACCGATCGGGCCATGGGC
ACCTCGCTATCGTATCACATCTCGAAGCGTTACGGCGAGGCTGGCCTTCCGCTCGACACGGTCCACGTGAGCATC
AAGGGATCGGCTGGGCAGTCCTTCGGCGCCTTCCTGGCCCCCGGTGTGACGCTGGAATTGGAGGGAGACGCCAAC
GACTACGTCGGCAAGGGCCTATCTGGTGGGCGGCTGATCATCTACCCGCCGCGCGCCGCCGTCTTCAAGGCCGAG
GAGAACATCCTGATCGGTAACGTGTGCCTCTATGGCGCCACGAGCGGGACGTGTTTCTTCCGCGGCGTCGCGGCC
GAGCGCTTCGCTGTCCGCAACTCGGGCGCCACGGCCGTCGTCGAGGGCGTCGGCGATCACGGCTGCGAGTATATG
ACAGGCGGCCGTGTCGTCATCCTCGGCAGCACAGGTCGGAACTTTGCGGCCGGCATGTCGGGCGGCATCGCCTAC
ATCCTCGACGTCCAACGCGACTTTGACTCGAAGCTCAACACGGAGATGGTTGAGGCCGGACCGCTCGAGGATCCG
GCCGAGATCGCCTACCTGCGCGGGCTCATCGAGGACCATCATCACTACACGGGGTCGGAGCGGGCGGCACGCATC
CTGGTCGACTTTACGCGGGCGCTCCCTCGCTTCGTCAAAGTGCTGCCGGTCGACTACAAGCGCGTGATGGAGGAG
GAGGCGGCCAAGGCGGCGGCGGCCAAGCGCGCCGAATACACGCTGCCGGTCGTGTCCGGACCCAAGCACAAGGCC
TCGGCGGACAAGGTCAAGATGCAGGACATGGAAGAGGCCGTCGGCGACAAGGCGGCGGAGAAGAAGCGGGCGCTG
GTGCTGGACAAGACTCGAGGCTTCATGAAGTACGCTCGAAGGTCGGAGAAGTACAGGTCCGTCAACACGCGCGTC
AAGGACTGGGCCGAGCTCAGCTCGCGGCTGGACGAGGATGAGCTCAAGTACCAGTCGGCGCGCTGCATGGACTGC
GGTGTGCCGTTTTGCCAGTCGGAGACGGGCTGCCCCATCTCCAACATCATCCCCAAGTGGAACGAGCTGGTGTTC
CAGAACCAGTGGAGGGACGCGCTCAACCGGCTGCTCATGACCAACAACTTCCCCGAGTTCACGGGCCGCGTGTGT
CCGGCGCCGTGCGAAGGCGCCTGCGTGCTGGGCATCAACGAGGATCCGGTGGGCATCAAGTCGATCGAGTGCGCC
ATCATCGACCGCGGCTTCGAGATGGGCTGGATGGTGCCGCAGCCGCCGGCGATGCGGACGGGCAAGAAGGTGGCC
ATCATCGGCTCCGGGCCGGCCGGGCTGGCGTGCGCCGACCAGCTCAACCGGGCCGGTCACAGCGTGACGGTGTAT
GAGCGGGCTGACCGGCTGGGCGGGCTGCTCATGTACGGCATTCCCAACATGAAGCTGGACAAGCGCGTGGTCAAG
CGACGAACCGACTTCATGGCGGCCGAGGGCGTCGACTTCCGGACGGGCGTCTCGGTCGGCGAGCCGGGACAGCCG
AGCCTGACGGATCTCCGGGCCAACCACGATGCCGTTGTCATCGCCACGGGCGCGACGGTGGCGCGCGACCTGGCA
ATCAAGGGTCGCGAGCTGGAGGGCATCCACCTGGCCATGGAGTTCTTGCACAAGAACACCAAGTCGCTGCTGGAT
TCGGAGCTGGCGGATGAGGCCTACATCTCGGCCAAGGACAAGCACGTCGTCGTCATCGGCGGAGGCGACACGGGC
AACGACTGCATCGGCACGTCGGTGCGGCACGGGGCGACGTCGGTGACCAACTTTGAGCTGCTCCCGCAGCCTCCG
CCAGAGCGGGCGAGCGACAATCCTTGGCCGCAGTGGCCTCGCATCTACCGCGTCGACTACGGGCACAGCGAGGTG
CGGCAGCATACGGGCAAGGACCCGCGTGAGTACTGCATCATGTCGGAGGAGTTCATCGGCGATGGCGAGGGACGG
GTCAAGGGCATCAAGACGATGCGCGTCGAGTGGACCAAGTCTCCGAGCGGTGGATGGGACATGAAGAAGGTGGAC
GGATCGCAGCAGTTCTTCCCGGCCGACCTGGTGCTGCTGGCCATGGGTTTCCTCGGGCCCGAGTCGCGGGCGCTG
GGCGACGAGATTGAGAAGGACGGCCGCAAGAACGTCAAGACGCCGCCGGGGCGATACTGCACCAACTTGGAGGGC
GTATTCGCTGCCGGAGACGCGCGTCGCGGACAGTCGCTGATTGTGTGGTACGTGGCCGGGCCCTTTTGACTCTCT
GGCATTCTTTCATCGGCTAACTCGCGTCCAGGGGAATCAATGAAGGGCGGATGGCAGCGCGCGAGGTGGATCTGT
ATCTCGAAAAGTGCACCAGCCTTCCGGTGACGGGCGGCATCGTGAAGCGGACGGCGCAGGAGATTCTGGCGAGGA
TCGAGACTCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail