Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00478
Gene name
Locationscaffold_01:1911922..1913068
Strand-
Gene length (bp)1146
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03101 FAR1 FAR1 DNA-binding domain 4.5E-08 30 108

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2662 0.925 0.05 0.0144 0.0825 0.0095 0.039 0.0127 0.0144 0.003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1827
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7723
Ophiocordyceps australis map64 (Brazil) OphauB2|5889
Ophiocordyceps camponoti-floridani Ophcf2|00478 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4066
Ophiocordyceps kimflemingae Ophio5|1283
Ophiocordyceps subramaniannii Hirsu2|1809

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00478
MFGILEAVSVPHSGVYASCEDLMRDLNSRAEKEGYKIVKARSDRSRPGGPIIRADLVCERGGRPYRCQATKHKTS
TKKTNCPWKAKAVDRKLLGGWVLTIICDHHNHEPGTPEPPTPSEGSDVGEEETTVRPEGPRPDDETAVALQVAGV
SDAVLRLSGDTFHRFKGEYRKMSQPERLGILAQMQLRIAAIYAVQNEDMQRQKRQDAQDKRHREIEENKRRLEAG
GLHSAKRLRGVPPAPSADESPSGGGTGQRQYSRIAPAPGPVIQEPHFQPVSGITAEPTPQMSFQAYPGPPKRRRQ
SRTAAAATAQQPQQQQQSGQQPAQQQVQHQSQQQQQSQQQHPEPLATGTNAAVQVAESAKS*
Coding >Ophcf2|00478
ATGTTTGGGATCCTCGAGGCCGTCTCTGTCCCACACAGCGGCGTCTACGCGTCATGCGAGGACCTCATGCGCGAT
CTCAACTCGCGTGCCGAGAAGGAGGGCTACAAGATCGTCAAGGCTCGCTCCGATCGCTCCAGGCCTGGCGGGCCC
ATCATCCGTGCCGACCTCGTTTGTGAGCGCGGCGGACGGCCCTACCGATGTCAGGCTACAAAGCACAAGACTTCG
ACCAAGAAGACCAATTGTCCCTGGAAGGCCAAGGCCGTCGACCGGAAGCTGCTCGGCGGTTGGGTCCTGACCATC
ATCTGCGACCACCACAACCACGAGCCTGGCACACCCGAACCGCCAACGCCGTCAGAGGGCAGCGATGTGGGCGAA
GAGGAGACGACTGTAAGGCCTGAAGGCCCAAGGCCGGATGACGAGACGGCCGTCGCGCTCCAGGTGGCCGGTGTC
TCCGATGCCGTATTACGTCTCAGCGGCGACACGTTTCACCGCTTCAAGGGCGAGTATCGCAAGATGTCCCAGCCC
GAGCGACTCGGCATCCTGGCCCAGATGCAGCTTCGGATCGCGGCCATCTACGCCGTCCAGAACGAAGACATGCAG
CGTCAGAAGCGACAGGACGCCCAAGACAAGCGTCACAGAGAGATTGAAGAGAACAAACGCCGTCTGGAAGCGGGC
GGCCTCCACTCTGCTAAGAGGCTTCGTGGTGTGCCGCCCGCCCCGTCTGCCGATGAGTCGCCATCCGGAGGGGGA
ACTGGTCAGCGGCAGTACTCCCGCATCGCCCCGGCGCCGGGACCGGTCATTCAAGAGCCGCATTTTCAGCCGGTA
TCCGGCATAACGGCCGAACCGACGCCGCAAATGTCTTTTCAAGCTTACCCAGGGCCTCCTAAACGGAGGCGTCAG
TCGCGGACGGCGGCGGCGGCGACGGCACAGCAGCCACAGCAGCAACAGCAGTCGGGCCAGCAGCCAGCTCAGCAA
CAGGTCCAGCATCAGTCGCAGCAGCAGCAGCAGTCTCAACAACAGCATCCAGAGCCGCTGGCGACCGGTACGAAT
GCTGCGGTGCAGGTGGCCGAGTCGGCCAAGTCTTGA
Transcript >Ophcf2|00478
ATGTTTGGGATCCTCGAGGCCGTCTCTGTCCCACACAGCGGCGTCTACGCGTCATGCGAGGACCTCATGCGCGAT
CTCAACTCGCGTGCCGAGAAGGAGGGCTACAAGATCGTCAAGGCTCGCTCCGATCGCTCCAGGCCTGGCGGGCCC
ATCATCCGTGCCGACCTCGTTTGTGAGCGCGGCGGACGGCCCTACCGATGTCAGGCTACAAAGCACAAGACTTCG
ACCAAGAAGACCAATTGTCCCTGGAAGGCCAAGGCCGTCGACCGGAAGCTGCTCGGCGGTTGGGTCCTGACCATC
ATCTGCGACCACCACAACCACGAGCCTGGCACACCCGAACCGCCAACGCCGTCAGAGGGCAGCGATGTGGGCGAA
GAGGAGACGACTGTAAGGCCTGAAGGCCCAAGGCCGGATGACGAGACGGCCGTCGCGCTCCAGGTGGCCGGTGTC
TCCGATGCCGTATTACGTCTCAGCGGCGACACGTTTCACCGCTTCAAGGGCGAGTATCGCAAGATGTCCCAGCCC
GAGCGACTCGGCATCCTGGCCCAGATGCAGCTTCGGATCGCGGCCATCTACGCCGTCCAGAACGAAGACATGCAG
CGTCAGAAGCGACAGGACGCCCAAGACAAGCGTCACAGAGAGATTGAAGAGAACAAACGCCGTCTGGAAGCGGGC
GGCCTCCACTCTGCTAAGAGGCTTCGTGGTGTGCCGCCCGCCCCGTCTGCCGATGAGTCGCCATCCGGAGGGGGA
ACTGGTCAGCGGCAGTACTCCCGCATCGCCCCGGCGCCGGGACCGGTCATTCAAGAGCCGCATTTTCAGCCGGTA
TCCGGCATAACGGCCGAACCGACGCCGCAAATGTCTTTTCAAGCTTACCCAGGGCCTCCTAAACGGAGGCGTCAG
TCGCGGACGGCGGCGGCGGCGACGGCACAGCAGCCACAGCAGCAACAGCAGTCGGGCCAGCAGCCAGCTCAGCAA
CAGGTCCAGCATCAGTCGCAGCAGCAGCAGCAGTCTCAACAACAGCATCCAGAGCCGCTGGCGACCGGTACGAAT
GCTGCGGTGCAGGTGGCCGAGTCGGCCAAGTCTTGA
Gene >Ophcf2|00478
ATGTTTGGGATCCTCGAGGCCGTCTCTGTCCCACACAGCGGCGTCTACGCGTCATGCGAGGACCTCATGCGCGAT
CTCAACTCGCGTGCCGAGAAGGAGGGCTACAAGATCGTCAAGGCTCGCTCCGATCGCTCCAGGCCTGGCGGGCCC
ATCATCCGTGCCGACCTCGTTTGTGAGCGCGGCGGACGGCCCTACCGATGTCAGGCTACAAAGCACAAGACTTCG
ACCAAGAAGACCAATTGTCCCTGGAAGGCCAAGGCCGTCGACCGGAAGCTGCTCGGCGGTTGGGTCCTGACCATC
ATCTGCGACCACCACAACCACGAGCCTGGCACACCCGAACCGCCAACGCCGTCAGAGGGCAGCGATGTGGGCGAA
GAGGAGACGACTGTAAGGCCTGGTAAGCGAGCTGCCTCGTCTCCCCTGAACTCGAACTCGGACTGAGCTTCTCTC
CCCGCAGAAGGCCCAAGGCCGGATGACGAGACGGCCGTCGCGCTCCAGGTGGCCGGTGTCTCCGATGCCGTATTA
CGTCTCAGCGGCGACACGTTTCACCGCTTCAAGGGCGAGTATCGCAAGATGTCCCAGCCCGAGCGACTCGGCATC
CTGGCCCAGATGCAGCTTCGGATCGCGGCCATCTACGCCGTCCAGAACGAAGACATGCAGCGTCAGAAGCGACAG
GACGCCCAAGACAAGCGTCACAGAGAGATTGAAGAGAACAAACGCCGTCTGGAAGCGGGCGGCCTCCACTCTGCT
AAGAGGCTTCGTGGTGTGCCGCCCGCCCCGTCTGCCGATGAGTCGCCATCCGGAGGGGGAACTGGTCAGCGGCAG
TACTCCCGCATCGCCCCGGCGCCGGGACCGGTCATTCAAGAGCCGCATTTTCAGCCGGTATCCGGCATAACGGCC
GAACCGACGCCGCAAATGTCTTTTCAAGCTTACCCAGGGCCTCCTAAACGGAGGCGTCAGTCGCGGACGGCGGCG
GCGGCGACGGCACAGCAGCCACAGCAGCAACAGCAGTCGGGCCAGCAGCCAGCTCAGCAACAGGTCCAGCATCAG
TCGCAGCAGCAGCAGCAGTCTCAACAACAGCATCCAGAGCCGCTGGCGACCGGTACGAATGCTGCGGTGCAGGTG
GCCGAGTCGGCCAAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail