Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00476
Gene name
Locationscaffold_01:1906545..1909414
Strand-
Gene length (bp)2869
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 6.5E-157 145 598
PF02358 Trehalose_PPase Trehalose-phosphatase 9.0E-39 630 845

GO

GO Term Description Terminal node
GO:0005992 trehalose biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0005984 disaccharide metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0005991 trehalose metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0008152 metabolic process No
GO:0046351 disaccharide biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0005975 carbohydrate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009312 oligosaccharide biosynthetic process No
GO:0008150 biological_process No
GO:0034637 cellular carbohydrate biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6683 0.2831 0.5547 0.0658 0.1934 0.0249 0.0969 0.2642 0.2092 0.0465

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT20 1.8E-155 151 599

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3233
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7721
Ophiocordyceps australis map64 (Brazil) OphauB2|5887
Ophiocordyceps camponoti-floridani Ophcf2|00476 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4068
Ophiocordyceps kimflemingae Ophio5|1281
Ophiocordyceps subramaniannii Hirsu2|5841

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00476
MTVFICSLFLPKTIQFNLPGTPPRRRGDGLRRRTRSTAQPSRPPSLFSPPRPDLTPPQTPVDDGPGSPNPFANED
GSRVPSTSPPPVAADDAVPSWGVRLDQPLSRARSPPPAALVRKAGELGRRGITQPKASARSDSHDRVFSSAPWRV
VDADQGNGGLRNAVRAAARDGRLAPDYTWVGTLGMPTDALDGSEQQRAIERVLADDDRMLAVFCSDRDFDGHYSH
FCKQMLWPVFHYQIPDNPKSKAYEDHSWKYYVNVNRRFADAIVARWRPGDVVWVHDYHLLLVPGMLRRALPEARI
GFFLHVAFPSSEVFRCLAVRRELLEGVLGANLVGFQIGEYARHFLQTCSRLLAVEATPQGVQLEDRFVDVVSMAI
GIDPISLAAHRASDDVARWIRILGDRYRDKRLIVARDKLDHVRGVRQKLLTYELFLERNPQWRGRTVLIQVALSS
GETSDLDASVSDIVTRVNSAWANLAYQPVVYLKQDIDYAQYLALLTVADVLMITSQREGMNLTSHEYVACQDGRH
GSLILSEFAGTASLFAGSELSVNPWNHRQCADAILRALEMADDERRRRWERLHGCVARHTGSAWVGEMLGRLERA
DGRPGPRGGLDMDDVAARYRAAAGRRRLLLLDYEGTLVSWGPVDRIIPVSPQRTLDVLNELLLDPANVVFVMSGR
RPEELDTVFRQVPGLGLIAENGCFIRGPSDAAWTDVSEEERIEDWKRAVTPIMRYYLERTPGATMEERHCSLLFH
HGGADDREAAARQASDCASHINDACEAQRVHAVAVGDSMVVEPLDYDKSTAAQHVLDRLDGGVDFLLVAGDGRDD
EKVFLWAKRLGDEGVVADVVTGVSGLLSRLRQLAALES*
Coding >Ophcf2|00476
ATGACCGTCTTCATCTGTTCCCTCTTCCTCCCCAAGACGATCCAGTTCAACCTCCCCGGAACGCCACCTCGACGG
CGCGGCGATGGATTACGACGACGGACGCGATCGACGGCTCAGCCGAGCCGACCGCCGAGTCTGTTCAGCCCGCCA
CGGCCGGACCTGACGCCGCCGCAGACGCCGGTAGACGACGGGCCGGGATCGCCGAATCCCTTCGCCAACGAGGAC
GGCTCGCGGGTGCCGTCGACGTCGCCTCCTCCGGTGGCGGCCGACGATGCGGTGCCGTCGTGGGGCGTCCGGTTG
GATCAGCCGCTGTCTCGGGCCCGGTCGCCGCCGCCGGCAGCGCTGGTGAGGAAGGCGGGCGAGCTGGGGCGAAGG
GGCATCACGCAGCCCAAGGCTTCGGCTCGCAGCGACAGTCATGATCGTGTCTTTTCGTCGGCGCCGTGGCGGGTC
GTTGACGCTGATCAGGGAAACGGGGGGCTGCGCAATGCCGTACGGGCGGCTGCTCGTGATGGTAGGCTCGCGCCC
GACTACACCTGGGTCGGCACGCTGGGGATGCCGACGGATGCGCTCGACGGGTCCGAGCAGCAGCGGGCCATCGAG
CGTGTCTTGGCCGATGACGACCGCATGCTGGCCGTCTTCTGCTCGGACCGCGACTTTGACGGTCACTACAGCCAC
TTTTGCAAGCAGATGCTCTGGCCCGTCTTCCATTACCAGATCCCGGATAATCCCAAGAGCAAGGCGTACGAGGAT
CACTCGTGGAAGTACTACGTCAACGTCAACCGGCGCTTCGCCGACGCCATCGTGGCCCGGTGGAGGCCGGGCGAC
GTGGTCTGGGTGCACGACTATCACCTGCTGCTGGTGCCGGGCATGTTGCGACGAGCGCTGCCCGAGGCTCGCATC
GGCTTCTTCCTCCACGTGGCCTTTCCGTCGTCGGAGGTGTTCCGCTGTCTGGCGGTGCGGCGGGAGCTGCTCGAG
GGCGTGCTGGGTGCTAACCTGGTAGGCTTCCAGATCGGAGAGTACGCGCGTCACTTCTTGCAGACGTGCAGCCGG
CTGCTGGCGGTGGAGGCGACGCCGCAGGGTGTCCAGCTCGAGGACAGGTTCGTCGACGTCGTGTCCATGGCCATC
GGCATCGACCCCATCAGCCTGGCGGCGCACCGGGCCAGCGACGACGTGGCGCGCTGGATTCGCATTCTCGGTGAT
CGCTACCGCGACAAGCGGCTCATCGTGGCTCGCGACAAGCTCGATCACGTCCGCGGCGTGCGGCAGAAGCTGCTG
ACGTACGAGCTCTTCCTGGAACGCAACCCGCAGTGGCGAGGACGGACGGTGCTCATCCAGGTGGCGCTCTCGTCG
GGCGAGACGTCGGACCTGGACGCGTCCGTGTCGGACATTGTGACGCGCGTCAACTCGGCCTGGGCCAACCTGGCC
TACCAGCCCGTCGTCTACCTCAAGCAGGACATTGACTACGCGCAGTACCTCGCGCTCCTGACGGTGGCCGACGTG
CTGATGATTACCAGCCAGCGCGAGGGCATGAACCTGACGTCGCACGAGTACGTGGCCTGTCAGGACGGGCGGCAC
GGGTCGCTCATCCTGTCCGAGTTTGCGGGTACGGCGTCGCTCTTTGCGGGCAGCGAGCTGTCGGTCAATCCGTGG
AACCACCGGCAGTGCGCCGACGCCATCCTCCGGGCGCTGGAGATGGCCGACGACGAGCGGAGGAGACGGTGGGAG
CGGCTGCACGGGTGCGTGGCGCGACACACGGGCTCCGCCTGGGTGGGCGAGATGCTGGGCCGACTCGAGCGGGCC
GACGGACGGCCGGGGCCCCGGGGCGGGCTGGACATGGACGACGTGGCGGCACGATACCGGGCGGCGGCCGGACGG
AGGCGGCTGCTGCTGCTCGACTACGAGGGGACGCTGGTCAGCTGGGGACCCGTGGATCGCATCATACCCGTCAGC
CCGCAGCGGACGCTCGACGTGCTCAACGAGCTGCTGCTGGACCCGGCCAACGTCGTCTTCGTCATGTCGGGCCGG
CGGCCGGAGGAGCTGGACACGGTGTTCCGGCAGGTGCCCGGGCTGGGCCTGATTGCCGAGAACGGGTGCTTCATC
CGGGGCCCTTCGGACGCGGCGTGGACGGACGTGTCGGAGGAAGAGCGGATCGAGGACTGGAAGCGAGCCGTGACG
CCCATCATGCGCTACTACCTGGAGCGGACGCCGGGGGCGACGATGGAGGAGCGGCACTGCAGCCTGCTGTTCCAC
CACGGCGGAGCAGACGATCGCGAGGCCGCGGCGCGTCAGGCGTCGGACTGCGCCAGCCACATCAACGACGCGTGC
GAGGCCCAGCGGGTTCACGCCGTGGCAGTCGGGGACTCGATGGTGGTAGAACCGCTCGACTACGACAAGAGCACG
GCGGCGCAGCACGTGCTGGACCGGCTGGACGGAGGCGTCGACTTCTTGCTGGTGGCGGGGGACGGGAGGGACGAC
GAGAAGGTGTTTCTGTGGGCGAAGCGTCTCGGCGACGAGGGCGTCGTGGCGGATGTGGTGACGGGGGTGAGCGGT
CTGCTGAGCCGGTTGCGACAGCTGGCGGCGCTGGAGTCGTAG
Transcript >Ophcf2|00476
ATGACCGTCTTCATCTGTTCCCTCTTCCTCCCCAAGACGATCCAGTTCAACCTCCCCGGAACGCCACCTCGACGG
CGCGGCGATGGATTACGACGACGGACGCGATCGACGGCTCAGCCGAGCCGACCGCCGAGTCTGTTCAGCCCGCCA
CGGCCGGACCTGACGCCGCCGCAGACGCCGGTAGACGACGGGCCGGGATCGCCGAATCCCTTCGCCAACGAGGAC
GGCTCGCGGGTGCCGTCGACGTCGCCTCCTCCGGTGGCGGCCGACGATGCGGTGCCGTCGTGGGGCGTCCGGTTG
GATCAGCCGCTGTCTCGGGCCCGGTCGCCGCCGCCGGCAGCGCTGGTGAGGAAGGCGGGCGAGCTGGGGCGAAGG
GGCATCACGCAGCCCAAGGCTTCGGCTCGCAGCGACAGTCATGATCGTGTCTTTTCGTCGGCGCCGTGGCGGGTC
GTTGACGCTGATCAGGGAAACGGGGGGCTGCGCAATGCCGTACGGGCGGCTGCTCGTGATGGTAGGCTCGCGCCC
GACTACACCTGGGTCGGCACGCTGGGGATGCCGACGGATGCGCTCGACGGGTCCGAGCAGCAGCGGGCCATCGAG
CGTGTCTTGGCCGATGACGACCGCATGCTGGCCGTCTTCTGCTCGGACCGCGACTTTGACGGTCACTACAGCCAC
TTTTGCAAGCAGATGCTCTGGCCCGTCTTCCATTACCAGATCCCGGATAATCCCAAGAGCAAGGCGTACGAGGAT
CACTCGTGGAAGTACTACGTCAACGTCAACCGGCGCTTCGCCGACGCCATCGTGGCCCGGTGGAGGCCGGGCGAC
GTGGTCTGGGTGCACGACTATCACCTGCTGCTGGTGCCGGGCATGTTGCGACGAGCGCTGCCCGAGGCTCGCATC
GGCTTCTTCCTCCACGTGGCCTTTCCGTCGTCGGAGGTGTTCCGCTGTCTGGCGGTGCGGCGGGAGCTGCTCGAG
GGCGTGCTGGGTGCTAACCTGGTAGGCTTCCAGATCGGAGAGTACGCGCGTCACTTCTTGCAGACGTGCAGCCGG
CTGCTGGCGGTGGAGGCGACGCCGCAGGGTGTCCAGCTCGAGGACAGGTTCGTCGACGTCGTGTCCATGGCCATC
GGCATCGACCCCATCAGCCTGGCGGCGCACCGGGCCAGCGACGACGTGGCGCGCTGGATTCGCATTCTCGGTGAT
CGCTACCGCGACAAGCGGCTCATCGTGGCTCGCGACAAGCTCGATCACGTCCGCGGCGTGCGGCAGAAGCTGCTG
ACGTACGAGCTCTTCCTGGAACGCAACCCGCAGTGGCGAGGACGGACGGTGCTCATCCAGGTGGCGCTCTCGTCG
GGCGAGACGTCGGACCTGGACGCGTCCGTGTCGGACATTGTGACGCGCGTCAACTCGGCCTGGGCCAACCTGGCC
TACCAGCCCGTCGTCTACCTCAAGCAGGACATTGACTACGCGCAGTACCTCGCGCTCCTGACGGTGGCCGACGTG
CTGATGATTACCAGCCAGCGCGAGGGCATGAACCTGACGTCGCACGAGTACGTGGCCTGTCAGGACGGGCGGCAC
GGGTCGCTCATCCTGTCCGAGTTTGCGGGTACGGCGTCGCTCTTTGCGGGCAGCGAGCTGTCGGTCAATCCGTGG
AACCACCGGCAGTGCGCCGACGCCATCCTCCGGGCGCTGGAGATGGCCGACGACGAGCGGAGGAGACGGTGGGAG
CGGCTGCACGGGTGCGTGGCGCGACACACGGGCTCCGCCTGGGTGGGCGAGATGCTGGGCCGACTCGAGCGGGCC
GACGGACGGCCGGGGCCCCGGGGCGGGCTGGACATGGACGACGTGGCGGCACGATACCGGGCGGCGGCCGGACGG
AGGCGGCTGCTGCTGCTCGACTACGAGGGGACGCTGGTCAGCTGGGGACCCGTGGATCGCATCATACCCGTCAGC
CCGCAGCGGACGCTCGACGTGCTCAACGAGCTGCTGCTGGACCCGGCCAACGTCGTCTTCGTCATGTCGGGCCGG
CGGCCGGAGGAGCTGGACACGGTGTTCCGGCAGGTGCCCGGGCTGGGCCTGATTGCCGAGAACGGGTGCTTCATC
CGGGGCCCTTCGGACGCGGCGTGGACGGACGTGTCGGAGGAAGAGCGGATCGAGGACTGGAAGCGAGCCGTGACG
CCCATCATGCGCTACTACCTGGAGCGGACGCCGGGGGCGACGATGGAGGAGCGGCACTGCAGCCTGCTGTTCCAC
CACGGCGGAGCAGACGATCGCGAGGCCGCGGCGCGTCAGGCGTCGGACTGCGCCAGCCACATCAACGACGCGTGC
GAGGCCCAGCGGGTTCACGCCGTGGCAGTCGGGGACTCGATGGTGGTAGAACCGCTCGACTACGACAAGAGCACG
GCGGCGCAGCACGTGCTGGACCGGCTGGACGGAGGCGTCGACTTCTTGCTGGTGGCGGGGGACGGGAGGGACGAC
GAGAAGGTGTTTCTGTGGGCGAAGCGTCTCGGCGACGAGGGCGTCGTGGCGGATGTGGTGACGGGGGTGAGCGGT
CTGCTGAGCCGGTTGCGACAGCTGGCGGCGCTGGAGTCGTAG
Gene >Ophcf2|00476
ATGACCGTCTTCATCTGTTCCCTGTGCGTTACCTACCTACTCTACTCCCCTCTACTCCCCTCTACTCCCCTCTAC
TCTACTCTACTCACCTGACTGCCCATCGGCGGATGGGATTTTCCCTCTCCGCTGCAATGCACGCTGGCTGACCAA
GGGAACCGTCCATTCCCTCACGACAGCTTCCTCCCCAAGACGATCCAGTTCAACCTCCCCGGAACGCCACCTCGA
CGGCGCGGCGATGGATTACGACGACGGACGCGATCGACGGCTCAGCCGAGCCGACCGCCGAGTCTGTTCAGCCCG
CCACGGCCGGACCTGACGCCGCCGCAGACGCCGGTAGACGACGGGCCGGGATCGCCGAATCCCTTCGCCAACGAG
GACGGCTCGCGGGTGCCGTCGACGTCGCCTCCTCCGGTGGCGGCCGACGATGCGGTGCCGTCGTGGGGCGTCCGG
TTGGATCAGCCGCTGTCTCGGGCCCGGTCGCCGCCGCCGGCAGCGCTGGTGAGGAAGGCGGGCGAGCTGGGGCGA
AGGGGCATCACGCAGCCCAAGGCTTCGGCTCGCAGCGACAGTCATGATCGTGTCTTTTCGTCGGCGCCGTGGCGG
GTCGTTGACGCTGATCAGGGAAACGGGGGGCTGCGCAATGCCGTACGGGCGGCTGCTCGTGATGGTAGGCTCGCG
CCCGACTACACCTGGGTCGGCACGCTGGGGATGCCGACGGATGCGCTCGACGGGTCCGAGCAGCAGCGGGCCATC
GAGCGTGTCTTGGCCGATGACGACCGCATGCTGGCCGTCTTCTGCTCGGACCGCGACTTTGACGGTCACTACAGC
CACTTTTGCAAGCAGATGCTCTGGCCCGTCTTCCATTACCAGATCCCGGATAATCCCAAGAGCAAGGCGTACGAG
GATCACTCGTGGAAGTACTACGTCAACGTCAACCGGCGCTTCGCCGACGCCATCGTGGCCCGGTGGAGGCCGGGC
GACGTGGTCTGGGTGCACGACTATCACCTGCTGCTGGTGCCGGGCATGTTGCGACGAGCGCTGCCCGAGGCTCGC
ATCGGCTTCTTCCTCCACGTGGCCTTTCCGTCGTCGGAGGTGTTCCGCTGTCTGGCGGTGCGGCGGGAGCTGCTC
GAGGGCGTGCTGGGTGCTAACCTGGTAGGCTTCCAGATCGGAGAGTACGCGCGTCACTTCTTGCAGACGTGCAGC
CGGCTGCTGGCGGTGGAGGCGACGCCGCAGGGTGTCCAGCTCGAGGACAGGTTCGTCGACGTCGTGTCCATGGCC
ATCGGCATCGACCCCATCAGCCTGGCGGCGCACCGGGCCAGCGACGACGTGGCGCGCTGGATTCGCATTCTCGGT
GATCGCTACCGCGACAAGCGGCTCATCGTGGCTCGCGACAAGCTCGATCACGTCCGCGGCGTGCGGCAGAAGCTG
CTGACGTACGAGCTCTTCCTGGAACGCAACCCGCAGTGGCGAGGACGGACGGTGCTCATCCAGGTGGCGCTCTCG
TCGGGCGAGACGTCGGACCTGGACGCGTCCGTGTCGGACATTGTGACGCGCGTCAACTCGGCCTGGGCCAACCTG
GCCTACCAGCCCGTCGTCTACCTCAAGCAGGACATTGACTACGCGCAGTACCTCGCGCTCCTGACGGTGGCCGAC
GTGCTGATGATTACCAGCCAGCGCGAGGGCATGAACCTGACGTCGCACGAGTACGTGGCCTGTCAGGACGGGCGG
CACGGGTCGCTCATCCTGTCCGAGTTTGCGGGTACGGCGTCGCTCTTTGCGGGCAGCGAGCTGTCGGTCAATCCG
TGGAACCACCGGCAGTGCGCCGACGCCATCCTCCGGGCGCTGGAGATGGCCGACGACGAGCGGAGGAGACGGTGG
GAGCGGCTGCACGGGTGCGTGGCGCGACACACGGGCTCCGCCTGGGTGGGCGAGATGCTGGGCCGACTCGAGCGG
GCCGACGGACGGCCGGGGCCCCGGGGCGGGCTGGACATGGACGACGTGGCGGCACGATACCGGGCGGCGGCCGGA
CGGAGGCGGCTGCTGCTGCTCGACTACGAGGGGACGCTGGTCAGCTGGGGACCCGTGGATCGCATCATACCCGTC
AGCCCGCAGCGGACGCTCGACGTGCTCAACGAGCTGCTGCTGGACCCGGCCAACGTCGTCTTCGTCATGTCGGGC
CGGCGGCCGGAGGAGCTGGACACGGTGTTCCGGCAGGTGCCCGGGCTGGGCCTGATTGCCGAGAACGGGTGCTTC
ATCCGGGGCCCTTCGGACGCGGCGTGGACGGACGTGTCGGAGGAAGAGCGGATCGAGGACTGGAAGCGAGCCGTG
ACGCCCATCATGCGCTACTACCTGGAGCGGACGCCGGGGGCGACGATGGAGGAGCGGCACTGCAGCCTGCTGTTC
CACCACGGCGGAGCAGACGATCGCGAGGCCGCGGCGCGTCAGGCGTCGGACTGCGCCAGCCACATCAACGACGCG
TGCGAGGCCCAGCGGGTTCACGCCGTGGCAGTCGGGGACTCGATGGTGGTAGAACCGCTCGACTACGACAAGAGC
ACGGCGGCGCAGCACGTGCTGGACCGGCTGGACGGAGGCGTCGACTTCTTGCTGGTGGCGGGGGACGGGAGGGAC
GACGAGAAGGTGTTTCTGTGGGCGAAGCGTCTCGGCGACGAGGGCGTCGTGGCGGATGTGGTGACGGTGAGCTTG
GGGGGGGTCGGAGTACGGAGGCGGGAGCGACGCTGACGCAGGGGGTGAGCGGTGAGTAATGAACGCTGGGTTGGT
GTCTTTGCTGGGAGTTTGTGATTGTGCTGATGTGACGGGTTGGGACCTAGGTCTGCTGAGCCGGTTGCGACAGCT
GGCGGCGCTGGAGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail