Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00473
Gene name
Locationscaffold_01:1900271..1900856
Strand+
Gene length (bp)585
Transcript length (bp)435
Coding sequence length (bp)435
Protein length (aa) 145

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 4.1E-28 80 144

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0969 0.041 0.9682 0.0796 0.133 0.0054 0.0575 0.1708 0.0768 0.0035

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999701

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6106
Ophiocordyceps australis 1348a (Ghana) OphauG2|989
Ophiocordyceps australis map64 (Brazil) OphauB2|4594
Ophiocordyceps australis map64 (Brazil) OphauB2|5882
Ophiocordyceps camponoti-floridani Ophcf2|00473 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1213
Ophiocordyceps camponoti-rufipedis Ophun1|3829
Ophiocordyceps camponoti-rufipedis Ophun1|6587
Ophiocordyceps kimflemingae Ophio5|1277
Ophiocordyceps kimflemingae Ophio5|22
Ophiocordyceps subramaniannii Hirsu2|10919
Ophiocordyceps subramaniannii Hirsu2|1373
Ophiocordyceps subramaniannii Hirsu2|5330
Ophiocordyceps subramaniannii Hirsu2|640

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00473
MKFLALTLLLVGALANPTHWHHGGGGGGGGSGSGGGNIGGGGGDNNGGGSNGGGGNGGGDNGGGNNNGGGGGGGG
GRFSCSPGLYSNAQCCATDVLGVADLDCKSPSRTPTSLADFNSICAGVGNRARCCVIPVAGLAVLCKDP*
Coding >Ophcf2|00473
ATGAAGTTCCTCGCCCTCACCCTCCTCCTCGTCGGCGCTCTCGCCAACCCCACGCACTGGCACCACGGCGGCGGC
GGTGGTGGTGGCGGCAGCGGTTCCGGCGGCGGTAACATCGGAGGCGGCGGCGGCGACAACAACGGAGGCGGCAGC
AACGGCGGAGGCGGCAACGGAGGAGGCGACAACGGAGGCGGCAACAACAACGGCGGTGGAGGCGGAGGCGGAGGC
GGCAGGTTCTCTTGCTCGCCCGGTCTCTACAGCAACGCGCAGTGCTGCGCCACCGACGTCCTCGGCGTTGCTGAC
CTCGACTGCAAGTCCCCCAGCCGGACTCCCACCAGCCTCGCCGACTTCAACTCCATCTGCGCCGGAGTTGGAAAC
CGTGCCCGCTGCTGCGTCATCCCCGTGGCTGGCCTCGCCGTCCTCTGCAAGGACCCTTAG
Transcript >Ophcf2|00473
ATGAAGTTCCTCGCCCTCACCCTCCTCCTCGTCGGCGCTCTCGCCAACCCCACGCACTGGCACCACGGCGGCGGC
GGTGGTGGTGGCGGCAGCGGTTCCGGCGGCGGTAACATCGGAGGCGGCGGCGGCGACAACAACGGAGGCGGCAGC
AACGGCGGAGGCGGCAACGGAGGAGGCGACAACGGAGGCGGCAACAACAACGGCGGTGGAGGCGGAGGCGGAGGC
GGCAGGTTCTCTTGCTCGCCCGGTCTCTACAGCAACGCGCAGTGCTGCGCCACCGACGTCCTCGGCGTTGCTGAC
CTCGACTGCAAGTCCCCCAGCCGGACTCCCACCAGCCTCGCCGACTTCAACTCCATCTGCGCCGGAGTTGGAAAC
CGTGCCCGCTGCTGCGTCATCCCCGTGGCTGGCCTCGCCGTCCTCTGCAAGGACCCTTAG
Gene >Ophcf2|00473
ATGAAGTTCCTCGCCCTCACCCTCCTCCTCGTCGGCGCTCTCGCCAACCCCACGCACTGGCACCACGGCGGCGGC
GGTGGTGGTGGCGGCAGCGGTTCCGGCGGCGGTAACATCGGAGGCGGCGGCGGCGACAACAACGGAGGCGGCAGC
AACGGCGGAGGCGGCAACGGAGGAGGCGACAACGGAGGCGGCAACAACAACGGCGGTGGAGGCGGAGGCGGAGGC
GGCAGGTTCTCTTGCTCGCCCGGTCTCTACAGCAACGCGCAGTGCTGCGCCACCGACGTCCTCGGCGTTGCTGAC
CTCGACTGCAAGTCCCGTAAGTCTTCCAGCTCGATACTCCCCAGCACGTCTCGCAAGAAGAGAGCCGGAAAAACT
GACCTGCTCAACAGCCAGCCGGACTCCCACCAGCCTCGCCGACTTCAACTCCATCTGCGCCGGAGTTGGAAACCG
TGCCCGCTGCTGCGTCATCCCCGTGGTAAGAAGCTACCCCCCCTTGATACAAGAAAAAGGGGGAAGAGAAGAGGA
AGAGGAGACTGACGAGCAATCGAATAGGCTGGCCTCGCCGTCCTCTGCAAGGACCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail