Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00471
Gene name
Locationscaffold_01:1893006..1894485
Strand-
Gene length (bp)1479
Transcript length (bp)1479
Coding sequence length (bp)1479
Protein length (aa) 493

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0847 0.1048 0.9199 0.0349 0.068 0.0051 0.0424 0.0493 0.0681 0.0014

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999805

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6034
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00471 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3828
Ophiocordyceps kimflemingae Ophio5|1274
Ophiocordyceps subramaniannii Hirsu2|1371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00471
MKFNAIVAIALVTGVSAAPQPWCKRPNSICPKVKRAADAVAEVAAQGATAELTHLLTLSEEQPDQYSSEALGIAL
DKREPEPWCTRPNSQCGPKKRSVEKREPEPWCYRPNSQCGPKKRSVEKREPEPWCTRPNSICSKVKRAADAVVEV
AALDATEELGQLLENNVQHSEALGFSDKTMDKRWCYRPNSQCGPKRSVDKREPEPWCTRPNSICSKVKRSPWCTR
PNSICSKVKRSLEKREPEPEPWCTRPNSQCGPKMAKREPTPWCTRPNSICSKVKRAIVERSPVPWCTRPNSICSK
VKRSLAKREPEPWCTRPNSQCGPKMAKREPEPWCTRPNSICSKVKRAADVFADTVQQSVKQDSAAPRTASEAAAH
DAVVELAQLLAQTGESPEEYIKSLGLNDSEDNKTVAKRDVEGTSETEAEEKEACLAEGGACWAAKRAVDAVLETV
NAEQDDAEEEAECSQRGEACWHQKRQLGALRFAANDISSSLL*
Coding >Ophcf2|00471
ATGAAGTTCAACGCCATCGTCGCCATCGCCCTCGTCACGGGCGTCTCTGCCGCGCCTCAGCCTTGGTGCAAGCGC
CCCAACTCCATCTGCCCCAAAGTCAAGAGAGCTGCCGATGCCGTGGCCGAAGTGGCCGCTCAGGGCGCCACTGCC
GAGCTCACTCACCTCCTGACGCTCTCGGAGGAACAGCCCGACCAGTACAGCTCCGAGGCTCTCGGCATCGCCCTC
GACAAGCGCGAGCCTGAACCCTGGTGCACACGTCCCAACTCGCAGTGTGGCCCCAAGAAGAGGTCCGTCGAAAAG
CGCGAGCCTGAGCCTTGGTGCTACCGTCCCAACTCGCAGTGTGGCCCCAAGAAGAGGTCCGTCGAAAAGCGCGAG
CCTGAACCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGAGGGCCGCCGATGCAGTCGTCGAAGTG
GCCGCCCTCGATGCCACTGAAGAGCTCGGCCAGCTTCTGGAGAACAACGTACAGCACTCGGAGGCTCTCGGCTTC
TCCGACAAGACCATGGACAAGCGCTGGTGCTACCGTCCCAACTCGCAGTGCGGCCCCAAGAGGTCCGTCGATAAG
CGCGAGCCTGAGCCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGCGCAGCCCCTGGTGCACGCGA
CCCAACTCCATCTGCTCCAAGGTCAAGAGGTCCCTGGAGAAGCGCGAGCCCGAGCCCGAGCCCTGGTGCACGCGT
CCCAACTCGCAGTGCGGCCCCAAGATGGCCAAGCGTGAGCCTACTCCCTGGTGCACGCGCCCCAACTCCATCTGC
TCCAAGGTCAAGAGGGCCATCGTCGAGCGCTCGCCCGTCCCCTGGTGCACGCGACCCAACTCAATCTGCTCCAAG
GTCAAGAGGTCTCTGGCGAAGCGCGAGCCTGAGCCCTGGTGCACGCGTCCCAACTCGCAGTGCGGCCCCAAGATG
GCCAAGCGTGAGCCTGAGCCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGAGGGCTGCCGACGTC
TTCGCCGATACGGTCCAGCAGTCGGTGAAGCAGGACTCGGCCGCTCCCCGGACCGCCAGCGAAGCAGCCGCCCAT
GACGCCGTTGTCGAACTCGCCCAGCTCCTTGCTCAGACTGGCGAGAGCCCTGAGGAGTACATCAAGTCTCTCGGC
CTCAACGACAGCGAGGACAACAAGACCGTGGCCAAGCGCGACGTCGAAGGCACCAGCGAGACGGAAGCCGAGGAG
AAGGAGGCCTGCCTTGCCGAGGGCGGTGCTTGCTGGGCCGCCAAGAGAGCCGTCGACGCCGTCCTGGAAACCGTC
AATGCCGAGCAGGATGACGCCGAGGAGGAAGCCGAGTGCTCGCAGCGCGGAGAGGCCTGCTGGCACCAGAAGCGC
CAACTTGGAGCCCTGCGGTTCGCCGCCAACGACATCTCGTCCTCTCTCCTGTAA
Transcript >Ophcf2|00471
ATGAAGTTCAACGCCATCGTCGCCATCGCCCTCGTCACGGGCGTCTCTGCCGCGCCTCAGCCTTGGTGCAAGCGC
CCCAACTCCATCTGCCCCAAAGTCAAGAGAGCTGCCGATGCCGTGGCCGAAGTGGCCGCTCAGGGCGCCACTGCC
GAGCTCACTCACCTCCTGACGCTCTCGGAGGAACAGCCCGACCAGTACAGCTCCGAGGCTCTCGGCATCGCCCTC
GACAAGCGCGAGCCTGAACCCTGGTGCACACGTCCCAACTCGCAGTGTGGCCCCAAGAAGAGGTCCGTCGAAAAG
CGCGAGCCTGAGCCTTGGTGCTACCGTCCCAACTCGCAGTGTGGCCCCAAGAAGAGGTCCGTCGAAAAGCGCGAG
CCTGAACCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGAGGGCCGCCGATGCAGTCGTCGAAGTG
GCCGCCCTCGATGCCACTGAAGAGCTCGGCCAGCTTCTGGAGAACAACGTACAGCACTCGGAGGCTCTCGGCTTC
TCCGACAAGACCATGGACAAGCGCTGGTGCTACCGTCCCAACTCGCAGTGCGGCCCCAAGAGGTCCGTCGATAAG
CGCGAGCCTGAGCCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGCGCAGCCCCTGGTGCACGCGA
CCCAACTCCATCTGCTCCAAGGTCAAGAGGTCCCTGGAGAAGCGCGAGCCCGAGCCCGAGCCCTGGTGCACGCGT
CCCAACTCGCAGTGCGGCCCCAAGATGGCCAAGCGTGAGCCTACTCCCTGGTGCACGCGCCCCAACTCCATCTGC
TCCAAGGTCAAGAGGGCCATCGTCGAGCGCTCGCCCGTCCCCTGGTGCACGCGACCCAACTCAATCTGCTCCAAG
GTCAAGAGGTCTCTGGCGAAGCGCGAGCCTGAGCCCTGGTGCACGCGTCCCAACTCGCAGTGCGGCCCCAAGATG
GCCAAGCGTGAGCCTGAGCCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGAGGGCTGCCGACGTC
TTCGCCGATACGGTCCAGCAGTCGGTGAAGCAGGACTCGGCCGCTCCCCGGACCGCCAGCGAAGCAGCCGCCCAT
GACGCCGTTGTCGAACTCGCCCAGCTCCTTGCTCAGACTGGCGAGAGCCCTGAGGAGTACATCAAGTCTCTCGGC
CTCAACGACAGCGAGGACAACAAGACCGTGGCCAAGCGCGACGTCGAAGGCACCAGCGAGACGGAAGCCGAGGAG
AAGGAGGCCTGCCTTGCCGAGGGCGGTGCTTGCTGGGCCGCCAAGAGAGCCGTCGACGCCGTCCTGGAAACCGTC
AATGCCGAGCAGGATGACGCCGAGGAGGAAGCCGAGTGCTCGCAGCGCGGAGAGGCCTGCTGGCACCAGAAGCGC
CAACTTGGAGCCCTGCGGTTCGCCGCCAACGACATCTCGTCCTCTCTCCTGTAA
Gene >Ophcf2|00471
ATGAAGTTCAACGCCATCGTCGCCATCGCCCTCGTCACGGGCGTCTCTGCCGCGCCTCAGCCTTGGTGCAAGCGC
CCCAACTCCATCTGCCCCAAAGTCAAGAGAGCTGCCGATGCCGTGGCCGAAGTGGCCGCTCAGGGCGCCACTGCC
GAGCTCACTCACCTCCTGACGCTCTCGGAGGAACAGCCCGACCAGTACAGCTCCGAGGCTCTCGGCATCGCCCTC
GACAAGCGCGAGCCTGAACCCTGGTGCACACGTCCCAACTCGCAGTGTGGCCCCAAGAAGAGGTCCGTCGAAAAG
CGCGAGCCTGAGCCTTGGTGCTACCGTCCCAACTCGCAGTGTGGCCCCAAGAAGAGGTCCGTCGAAAAGCGCGAG
CCTGAACCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGAGGGCCGCCGATGCAGTCGTCGAAGTG
GCCGCCCTCGATGCCACTGAAGAGCTCGGCCAGCTTCTGGAGAACAACGTACAGCACTCGGAGGCTCTCGGCTTC
TCCGACAAGACCATGGACAAGCGCTGGTGCTACCGTCCCAACTCGCAGTGCGGCCCCAAGAGGTCCGTCGATAAG
CGCGAGCCTGAGCCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGCGCAGCCCCTGGTGCACGCGA
CCCAACTCCATCTGCTCCAAGGTCAAGAGGTCCCTGGAGAAGCGCGAGCCCGAGCCCGAGCCCTGGTGCACGCGT
CCCAACTCGCAGTGCGGCCCCAAGATGGCCAAGCGTGAGCCTACTCCCTGGTGCACGCGCCCCAACTCCATCTGC
TCCAAGGTCAAGAGGGCCATCGTCGAGCGCTCGCCCGTCCCCTGGTGCACGCGACCCAACTCAATCTGCTCCAAG
GTCAAGAGGTCTCTGGCGAAGCGCGAGCCTGAGCCCTGGTGCACGCGTCCCAACTCGCAGTGCGGCCCCAAGATG
GCCAAGCGTGAGCCTGAGCCCTGGTGCACACGTCCCAACTCCATCTGCTCCAAGGTCAAGAGGGCTGCCGACGTC
TTCGCCGATACGGTCCAGCAGTCGGTGAAGCAGGACTCGGCCGCTCCCCGGACCGCCAGCGAAGCAGCCGCCCAT
GACGCCGTTGTCGAACTCGCCCAGCTCCTTGCTCAGACTGGCGAGAGCCCTGAGGAGTACATCAAGTCTCTCGGC
CTCAACGACAGCGAGGACAACAAGACCGTGGCCAAGCGCGACGTCGAAGGCACCAGCGAGACGGAAGCCGAGGAG
AAGGAGGCCTGCCTTGCCGAGGGCGGTGCTTGCTGGGCCGCCAAGAGAGCCGTCGACGCCGTCCTGGAAACCGTC
AATGCCGAGCAGGATGACGCCGAGGAGGAAGCCGAGTGCTCGCAGCGCGGAGAGGCCTGCTGGCACCAGAAGCGC
CAACTTGGAGCCCTGCGGTTCGCCGCCAACGACATCTCGTCCTCTCTCCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail