Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00468
Gene name
Locationscaffold_01:1885905..1887438
Strand-
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07364 DUF1485 Metallopeptidase family M81 3.1E-97 7 300
PF07171 MlrC_C MlrC C-terminus 2.9E-56 311 482

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7661 0.4299 0.109 0.1402 0.093 0.0102 0.0325 0.0943 0.1233 0.0321

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7270
Ophiocordyceps australis map64 (Brazil) OphauB2|7991
Ophiocordyceps camponoti-floridani Ophcf2|00468 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3826
Ophiocordyceps kimflemingae Ophio5|1271
Ophiocordyceps subramaniannii Hirsu2|6134

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00468
MSRRPVIAIAGLACETSVFTKARTQVADFRPQRGDDVIGVYRFLHDDQPLGREARWKGALIGHALPGGMVTRQAF
EVLTREIVHRLEAMMAEESEEREEGIDGLWFDIHGAMCVEGLEDAEAELLRRVRSVLGQRVIVSASMDLHGNVSA
ELAHMCDLITCYRKAPHEDELETKERACRNLVKLLVATPASIRRPLKAWIPVPVLLPGEQTSTRVDPARRVYAAV
SEVAACEGVIDAAIWVGYPWADEPRNRAVVMVAGWEKGPVGEGAERLARLFWDARSEFKFVAAADSLNVCLDAAM
ASPTEERPFFVSDSGDNPTAGGSGDVTWSLTRILDRPEFKTDPGRYTVIYASLPAPSAVETAVAAGVGATVSVVA
GADVDDQFGPPVKMTGEVYAVKRGDKYAEMEVVLRVGCVLVILTKRRKPYHKESDFTDLKLRPREADIVIVKIGY
LEPELYDMANGWMLALTPGGVDQDLPRLGHKRIWRPMWPFDRVFEREPDLRTRWIASSDG*
Coding >Ophcf2|00468
ATGTCCCGACGTCCAGTAATCGCCATCGCCGGCCTGGCCTGCGAAACATCCGTCTTCACCAAGGCACGCACCCAA
GTAGCCGACTTCCGACCTCAGCGCGGAGACGACGTCATCGGCGTCTACCGCTTCCTGCATGACGACCAGCCGCTG
GGGCGGGAAGCGCGGTGGAAGGGCGCGCTGATAGGGCACGCGCTGCCTGGCGGTATGGTGACTCGCCAGGCGTTT
GAGGTCCTAACGAGGGAGATTGTGCATCGTTTGGAGGCTATGATGGCTGAAGAAAGTGAAGAAAGGGAGGAGGGT
ATCGATGGGCTGTGGTTCGATATTCACGGTGCCATGTGCGTTGAGGGACTGGAAGATGCCGAGGCAGAGCTCTTG
CGAAGAGTTCGTTCCGTCCTTGGGCAGCGAGTCATCGTCTCGGCTTCAATGGATCTCCATGGCAACGTCTCAGCC
GAACTCGCCCACATGTGCGACCTCATCACCTGCTACCGCAAGGCACCGCACGAGGACGAGCTGGAAACAAAGGAA
CGGGCGTGTCGCAACCTGGTGAAGCTACTCGTCGCAACTCCAGCTTCTATCCGTCGGCCACTCAAGGCATGGATC
CCCGTACCCGTCCTACTACCGGGAGAGCAGACTTCGACTCGAGTCGATCCCGCTCGTCGGGTGTATGCTGCCGTG
TCCGAGGTGGCAGCCTGCGAGGGCGTCATCGATGCTGCCATCTGGGTTGGATACCCGTGGGCCGATGAGCCGAGG
AACAGGGCCGTCGTCATGGTTGCCGGTTGGGAGAAGGGACCGGTGGGAGAAGGGGCGGAACGACTGGCCCGGCTG
TTCTGGGACGCGCGGTCCGAGTTCAAATTTGTGGCTGCAGCCGACTCGCTCAACGTCTGTCTAGACGCCGCCATG
GCCTCCCCGACCGAGGAGCGCCCATTCTTCGTGTCAGACTCTGGCGACAACCCGACCGCCGGCGGCTCCGGCGAC
GTCACCTGGAGTCTGACGAGGATCCTGGACCGGCCCGAGTTCAAGACGGATCCGGGGCGGTACACGGTCATATAC
GCCAGTCTACCGGCACCATCGGCGGTCGAGACGGCGGTGGCGGCGGGCGTGGGAGCCACCGTGAGTGTCGTTGCC
GGTGCCGACGTCGATGATCAGTTTGGGCCGCCGGTGAAGATGACGGGCGAGGTGTACGCTGTGAAGAGGGGGGAT
AAGTATGCCGAGATGGAGGTTGTTCTTCGCGTGGGATGCGTCCTTGTCATTCTTACCAAGAGGCGGAAGCCGTAT
CACAAGGAGAGTGACTTTACGGATCTGAAGCTACGGCCTAGGGAAGCCGATATCGTCATCGTCAAGATTGGATAT
CTGGAGCCGGAGCTGTACGACATGGCCAACGGGTGGATGCTGGCTCTTACACCGGGCGGTGTTGATCAGGACCTG
CCGAGGTTGGGGCATAAGCGGATTTGGAGGCCTATGTGGCCGTTTGATAGGGTCTTTGAGAGGGAGCCTGACCTG
CGAACGCGGTGGATTGCGAGCTCCGATGGATAA
Transcript >Ophcf2|00468
ATGTCCCGACGTCCAGTAATCGCCATCGCCGGCCTGGCCTGCGAAACATCCGTCTTCACCAAGGCACGCACCCAA
GTAGCCGACTTCCGACCTCAGCGCGGAGACGACGTCATCGGCGTCTACCGCTTCCTGCATGACGACCAGCCGCTG
GGGCGGGAAGCGCGGTGGAAGGGCGCGCTGATAGGGCACGCGCTGCCTGGCGGTATGGTGACTCGCCAGGCGTTT
GAGGTCCTAACGAGGGAGATTGTGCATCGTTTGGAGGCTATGATGGCTGAAGAAAGTGAAGAAAGGGAGGAGGGT
ATCGATGGGCTGTGGTTCGATATTCACGGTGCCATGTGCGTTGAGGGACTGGAAGATGCCGAGGCAGAGCTCTTG
CGAAGAGTTCGTTCCGTCCTTGGGCAGCGAGTCATCGTCTCGGCTTCAATGGATCTCCATGGCAACGTCTCAGCC
GAACTCGCCCACATGTGCGACCTCATCACCTGCTACCGCAAGGCACCGCACGAGGACGAGCTGGAAACAAAGGAA
CGGGCGTGTCGCAACCTGGTGAAGCTACTCGTCGCAACTCCAGCTTCTATCCGTCGGCCACTCAAGGCATGGATC
CCCGTACCCGTCCTACTACCGGGAGAGCAGACTTCGACTCGAGTCGATCCCGCTCGTCGGGTGTATGCTGCCGTG
TCCGAGGTGGCAGCCTGCGAGGGCGTCATCGATGCTGCCATCTGGGTTGGATACCCGTGGGCCGATGAGCCGAGG
AACAGGGCCGTCGTCATGGTTGCCGGTTGGGAGAAGGGACCGGTGGGAGAAGGGGCGGAACGACTGGCCCGGCTG
TTCTGGGACGCGCGGTCCGAGTTCAAATTTGTGGCTGCAGCCGACTCGCTCAACGTCTGTCTAGACGCCGCCATG
GCCTCCCCGACCGAGGAGCGCCCATTCTTCGTGTCAGACTCTGGCGACAACCCGACCGCCGGCGGCTCCGGCGAC
GTCACCTGGAGTCTGACGAGGATCCTGGACCGGCCCGAGTTCAAGACGGATCCGGGGCGGTACACGGTCATATAC
GCCAGTCTACCGGCACCATCGGCGGTCGAGACGGCGGTGGCGGCGGGCGTGGGAGCCACCGTGAGTGTCGTTGCC
GGTGCCGACGTCGATGATCAGTTTGGGCCGCCGGTGAAGATGACGGGCGAGGTGTACGCTGTGAAGAGGGGGGAT
AAGTATGCCGAGATGGAGGTTGTTCTTCGCGTGGGATGCGTCCTTGTCATTCTTACCAAGAGGCGGAAGCCGTAT
CACAAGGAGAGTGACTTTACGGATCTGAAGCTACGGCCTAGGGAAGCCGATATCGTCATCGTCAAGATTGGATAT
CTGGAGCCGGAGCTGTACGACATGGCCAACGGGTGGATGCTGGCTCTTACACCGGGCGGTGTTGATCAGGACCTG
CCGAGGTTGGGGCATAAGCGGATTTGGAGGCCTATGTGGCCGTTTGATAGGGTCTTTGAGAGGGAGCCTGACCTG
CGAACGCGGTGGATTGCGAGCTCCGATGGATAA
Gene >Ophcf2|00468
ATGTCCCGACGTCCAGTAATCGCCATCGCCGGCCTGGCCTGCGAAACATCCGTCTTCACCAAGGCACGCACCCAA
GTAGCCGACTTCCGACCTCAGCGCGGAGACGACGTCATCGGCGTCTACCGCTTCCTGCATGACGACCAGCCGCTG
GGGCGGGAAGCGCGGTGGAAGGGCGCGCTGATAGGGCACGCGCTGCCTGGCGGTATGGTGACTCGCCAGGCGTTT
GAGGTCCTAACGAGGGAGATTGTGCATCGTTTGGAGGCTATGATGGCTGAAGAAAGTGAAGAAAGGGAGGAGGGT
ATCGATGGGCTGTGGTTCGATATTCACGGTGCCATGTGCGTTGAGGGACTGGAAGATGCCGAGGCAGAGCTCTTG
CGAAGAGTTCGTTCCGTCCTTGGGCAGCGAGTCATCGTCTCGGCTTCAATGGATCTCCATGGCAACGTCTCAGCC
GAACTCGCCCACATGTGCGACCTCATCACCTGCTACCGCAAGGCACCGCACGAGGACGAGCTGGAAACAAAGGAA
CGGGCGTGTCGCAACCTGGTGAAGCTACTCGTCGCAACTCCAGCTTCTATCCGTCGGCCACTCAAGGCATGGATC
CCCGTACCCGTCCTACTACCGGGAGAGCAGACTTCGACTCGAGTCGATCCCGCTCGTCGGGTGTATGCTGCCGTG
TCCGAGGTGGCAGCCTGCGAGGGCGTCATCGATGCTGCCATCTGGGTTGGATACCCGTGGGCCGATGAGCCGAGG
AACAGGGCCGTCGTCATGGTTGCCGGTTGGGAGAAGGGACCGGTGGGAGAAGGGGCGGAACGACTGGCCCGGCTG
TTCTGGGACGCGCGGTCCGAGTTCAAATTTGTGGCTGCAGCCGACTCGCTCAACGTCTGTCTAGACGCCGCCATG
GCCTCCCCGACCGAGGAGCGCCCATTCTTCGTGTCAGACTCTGGCGACAACCCGACCGCCGGCGGCTCCGGCGAC
GTCACCTGGAGTCTGACGAGGATCCTGGACCGGCCCGAGTTCAAGACGGATCCGGGGCGGTACACGGTCATATAC
GCCAGTCTACCGGCACCATCGGCGGTCGAGACGGCGGTGGCGGCGGGCGTGGGAGCCACCGTGAGTGTCGTTGCC
GGTGCCGACGTCGATGATCAGTTTGGGCCGCCGGTGAAGATGACGGGCGAGGTGTACGCTGTGAAGAGGGGGGAT
AAGTATGCCGAGATGGAGGTTGTTCTTCGCGTGGGATGCGTCCTTGTCATTCTTACCAAGAGGCGGAAGCCGTAT
CACAAGGAGAGTGACTTTACGGATCTGAAGCTACGGCCTAGGGAAGCCGATATCGTCATCGTCAAGATTGGATAT
CTGGAGCCGGAGCTGTACGACATGGCCAACGGGTGGATGCTGGCTCTTACACCGGGCGGTGTTGATCAGGACCTG
CCGAGGTTGGGGCATAAGCGGATTTGGAGGCCTATGTGGCCGTTTGATAGGGTCTTTGAGAGGGAGCCTGACCTG
CGAACGCGGTGGATTGCGAGCTCCGATGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail