Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00460
Gene name
Locationscaffold_01:1859775..1861651
Strand+
Gene length (bp)1876
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11696 DUF3292 Protein of unknown function (DUF3292) 1.6E-201 9 550

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Transmembrane domain|Peroxisomal targeting signal 0.1258 0.2144 0.1007 0.2711 0.243 0.1321 0.5882 0.3412 0.5408 0.7748

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 140 162 22
2 315 332 17
3 339 358 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7263
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00460 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7081
Ophiocordyceps kimflemingae Ophio5|7691

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00460
MASSTEELPTTSHVLAAESIRSDPVDLRGASQTEHHEVEVKDLGWNETSDRHVPRQVLGGIDNHHLWTLMRRFDK
FVFRVRSIGDEPATRLDMDVADDDDFSPEKLRATVERLYVSVLVPIVSGWKHVARLRSWRERRRTSIFLAVYTAA
WLTDLLIPTMTVSTMMLILYPASRAVCFPPVPPALVDGRTGGVQKPAAGIMASRDSLTGAPEKQKGEGVEREAHN
LVNTLSTVAISASAGRRPRGDPHDDEAPDPTNMADSKAAMHDQTREPVSRAVWSKARPAMQLMGSSVDTWERFGN
ALSPTRPFPRLRPRLVLASCLTPLLVIWWLVTPYMLLKGLGFIIGLCLFGDPVIMAVVDKADRTYPTWQRYVQLR
NTILKGVPTNAQLTITLLRIGERNKAPLPPPPKTRGPPRAEPDAEAEEQLDNMEATDQEKKTAMERQHMSSEEED
DDDDDDLNDSNRHRGTQTRRLFALVKKTARSSVSAALTADRAKAAAGAHRARDRLGVVRPSPVPEVGTVAGPVRF
PARYDGRRGHAYVTTTATAPALSWRPSGG*
Coding >Ophcf2|00460
ATGGCTTCATCCACGGAAGAACTCCCGACGACGAGCCACGTCCTAGCCGCCGAGAGCATCCGCTCCGATCCCGTC
GACCTCCGGGGCGCGAGCCAGACGGAGCATCACGAGGTTGAAGTCAAGGATCTGGGCTGGAATGAGACGTCGGAT
CGGCATGTGCCTCGACAGGTGTTGGGCGGGATAGATAACCATCATCTGTGGACGTTGATGCGGCGCTTCGACAAG
TTCGTCTTTCGAGTTCGGTCTATTGGCGATGAGCCCGCGACGAGGCTGGATATGGACGTCGCGGATGACGACGAC
TTTTCACCCGAGAAGCTACGGGCTACCGTGGAGAGGCTCTACGTCTCCGTCCTCGTTCCCATCGTCTCTGGCTGG
AAGCATGTCGCCCGGTTGCGATCGTGGAGGGAGCGTCGTCGGACGAGCATCTTCCTGGCCGTCTATACCGCTGCC
TGGCTCACCGACCTGCTGATACCTACAATGACCGTGTCGACCATGATGTTGATCTTGTATCCGGCTTCGCGGGCC
GTTTGCTTCCCGCCCGTGCCGCCGGCTTTGGTAGATGGACGAACGGGGGGCGTTCAGAAGCCCGCTGCCGGCATC
ATGGCATCACGAGATTCACTGACGGGAGCCCCCGAGAAGCAAAAGGGAGAAGGCGTCGAGCGAGAAGCTCACAAC
CTAGTCAACACCTTGTCCACGGTGGCCATCAGCGCCTCAGCAGGCAGACGCCCTCGAGGAGACCCTCACGACGAC
GAGGCTCCCGATCCGACCAACATGGCAGACTCCAAGGCAGCCATGCACGATCAGACGCGCGAGCCCGTCTCCCGC
GCCGTCTGGAGCAAGGCGAGGCCTGCGATGCAGTTGATGGGAAGCTCGGTCGATACGTGGGAGCGCTTCGGCAAC
GCGCTGAGTCCGACGAGGCCGTTTCCCAGGCTGAGACCGCGGCTGGTGCTGGCATCGTGTCTGACGCCTCTGCTG
GTCATCTGGTGGCTGGTGACGCCGTATATGCTCCTCAAGGGGCTGGGTTTCATCATCGGACTTTGTCTATTCGGG
GATCCCGTCATCATGGCGGTCGTGGACAAGGCCGACAGGACATATCCCACATGGCAGCGCTACGTCCAGCTCCGG
AACACGATTCTCAAGGGCGTACCGACGAACGCGCAGCTGACCATTACGCTGCTGAGAATCGGCGAGAGAAACAAG
GCGCCCCTGCCGCCGCCGCCGAAGACGAGAGGGCCTCCACGGGCTGAGCCTGACGCGGAGGCGGAAGAACAGCTG
GATAACATGGAAGCAACAGACCAGGAAAAGAAAACAGCCATGGAGCGGCAGCACATGAGCTCCGAAGAAGAAGAC
GACGACGACGACGACGACCTCAACGACAGCAACCGTCACCGCGGCACCCAAACACGCCGTCTCTTCGCCCTCGTC
AAGAAAACAGCCCGAAGCAGCGTCTCAGCCGCCCTAACCGCCGACAGAGCCAAGGCCGCAGCCGGCGCCCACCGA
GCCCGAGACCGTCTCGGCGTCGTCCGTCCATCTCCGGTCCCGGAAGTGGGCACCGTCGCCGGCCCCGTCCGCTTC
CCCGCCCGGTACGACGGCCGGCGCGGTCACGCTTACGTCACGACGACGGCTACCGCCCCGGCTCTCAGCTGGAGG
CCGAGCGGGGGTTAG
Transcript >Ophcf2|00460
ATGGCTTCATCCACGGAAGAACTCCCGACGACGAGCCACGTCCTAGCCGCCGAGAGCATCCGCTCCGATCCCGTC
GACCTCCGGGGCGCGAGCCAGACGGAGCATCACGAGGTTGAAGTCAAGGATCTGGGCTGGAATGAGACGTCGGAT
CGGCATGTGCCTCGACAGGTGTTGGGCGGGATAGATAACCATCATCTGTGGACGTTGATGCGGCGCTTCGACAAG
TTCGTCTTTCGAGTTCGGTCTATTGGCGATGAGCCCGCGACGAGGCTGGATATGGACGTCGCGGATGACGACGAC
TTTTCACCCGAGAAGCTACGGGCTACCGTGGAGAGGCTCTACGTCTCCGTCCTCGTTCCCATCGTCTCTGGCTGG
AAGCATGTCGCCCGGTTGCGATCGTGGAGGGAGCGTCGTCGGACGAGCATCTTCCTGGCCGTCTATACCGCTGCC
TGGCTCACCGACCTGCTGATACCTACAATGACCGTGTCGACCATGATGTTGATCTTGTATCCGGCTTCGCGGGCC
GTTTGCTTCCCGCCCGTGCCGCCGGCTTTGGTAGATGGACGAACGGGGGGCGTTCAGAAGCCCGCTGCCGGCATC
ATGGCATCACGAGATTCACTGACGGGAGCCCCCGAGAAGCAAAAGGGAGAAGGCGTCGAGCGAGAAGCTCACAAC
CTAGTCAACACCTTGTCCACGGTGGCCATCAGCGCCTCAGCAGGCAGACGCCCTCGAGGAGACCCTCACGACGAC
GAGGCTCCCGATCCGACCAACATGGCAGACTCCAAGGCAGCCATGCACGATCAGACGCGCGAGCCCGTCTCCCGC
GCCGTCTGGAGCAAGGCGAGGCCTGCGATGCAGTTGATGGGAAGCTCGGTCGATACGTGGGAGCGCTTCGGCAAC
GCGCTGAGTCCGACGAGGCCGTTTCCCAGGCTGAGACCGCGGCTGGTGCTGGCATCGTGTCTGACGCCTCTGCTG
GTCATCTGGTGGCTGGTGACGCCGTATATGCTCCTCAAGGGGCTGGGTTTCATCATCGGACTTTGTCTATTCGGG
GATCCCGTCATCATGGCGGTCGTGGACAAGGCCGACAGGACATATCCCACATGGCAGCGCTACGTCCAGCTCCGG
AACACGATTCTCAAGGGCGTACCGACGAACGCGCAGCTGACCATTACGCTGCTGAGAATCGGCGAGAGAAACAAG
GCGCCCCTGCCGCCGCCGCCGAAGACGAGAGGGCCTCCACGGGCTGAGCCTGACGCGGAGGCGGAAGAACAGCTG
GATAACATGGAAGCAACAGACCAGGAAAAGAAAACAGCCATGGAGCGGCAGCACATGAGCTCCGAAGAAGAAGAC
GACGACGACGACGACGACCTCAACGACAGCAACCGTCACCGCGGCACCCAAACACGCCGTCTCTTCGCCCTCGTC
AAGAAAACAGCCCGAAGCAGCGTCTCAGCCGCCCTAACCGCCGACAGAGCCAAGGCCGCAGCCGGCGCCCACCGA
GCCCGAGACCGTCTCGGCGTCGTCCGTCCATCTCCGGTCCCGGAAGTGGGCACCGTCGCCGGCCCCGTCCGCTTC
CCCGCCCGGTACGACGGCCGGCGCGGTCACGCTTACGTCACGACGACGGCTACCGCCCCGGCTCTCAGCTGGAGG
CCGAGCGGGGGTTAG
Gene >Ophcf2|00460
ATGGCTTCATCCACGGAAGAACTCCCGACGACGAGCCACGTCCTAGCCGCCGAGAGCATCCGCTCCGATCCCGTC
GACCTCCGGGGCGCGAGCCAGACGGAGCATCACGAGGTTGAAGTCAAGGATCTGGGCTGGAATGAGACGTCGGAT
CGGCATGTGCCTCGACAGGTGTTGGGCGGGATAGATAACCATCATCTGTGGACGTTGATGCGGCGCTTCGACAAG
TTCGTCTTTCGAGTTCGGTCTATTGGCGATGAGCCCGCGACGAGGCTGGATATGGACGTCGCGGATGACGACGAC
TTTTCACCCGAGAAGCTACGGGCTACCGTGGAGAGGCTCTACGTCTCCGTCCTCGTTCCCATCGTCTCTGGCTGG
AAGCATGTCGCCCGGTTGCGATCGTGGAGGGAGCGTCGTCGGACGAGCATCTTCCTGGCCGTCTATACCGCTGCC
TGGCTCACCGACCTGCTGATACCTACAATGACCGTGTCGACCATGATGTTGATCTTGTATCCGGCTTCGCGGGCC
GTTTGCTTCCCGCCCGTGCCGCCGGCTTTGGTAGATGGACGAACGGGGGGCGTTCAGAAGCCCGCTGCCGGCATC
ATGGCATCACGAGATTCACTGACGGGAGCCCCCGAGAAGCAAAAGGGAGAAGGCGTCGAGCGAGAAGCTCACAAC
CTAGTCAACACCTTGTCCACGGTAAGTCTACCCCCGGAGACCCTCGTCTATGAGGCTGCTGATGTGCCAACTTGC
TCGTCTTTTTTTCCCCCCCGTGACGCTCTCCGTCTTCTGGCCACACCTGGGCTCATGGAACAGGATCGGATCAAC
TGATGCTCGCAACCAGGTGGCCATCAGCGCCTCAGCAGGCAGACGCCCTCGAGGAGACCCTCACGACGACGAGGC
TCCCGATCCGACCAACATGGCAGACTCCAAGGCAGCCATGCACGATCAGACGCGCGAGCCCGTCTCCCGCGCCGT
CTGGAGCAAGGCGAGGCCTGCGATGCAGTTGATGGGAAGCTCGGTCGATACGTGGGAGCGCTTCGGCAACGCGCT
GAGTCCGACGAGGCCGTTTCCCAGGCTGAGACCGCGGCTGGTGCTGGCATCGTGTCTGACGCCTCTGCTGGTCAT
CTGGTGGCTGGTGACGCCGTATATGCTCCTCAAGGGGCTGGGTTTCATCATCGGACTTTGTCTATTCGGGGATCC
CGTCATCATGGCGGTCGTGGACAAGGCCGACAGGACATATCCCACATGGCAGCGCTACGTCCAGCTCCGGAACAC
GATTCTCAAGGGCGTACCGACGAACGCGCAGCTGACCATTACGCTGCTGAGAATCGGCGAGAGAAACAAGGCGCC
CCTGCCGCCGCCGCCGAAGACGAGAGGGCCTCCACGGGCTGAGCCTGACGCGGAGGCGGAAGAACAGCTGGATAA
CATGGGTAACGAGAGACCAATGACGCCATTGAAGGAAACCGTACGAATACTGATGCTACATCCATCTGTAGAAGC
AACAGACCAGGAAAAGAAAACAGCCATGGAGCGGCAGCACATGAGCTCCGAAGAAGAAGACGACGACGACGACGA
CGACCTCAACGACAGCAACCGTCACCGCGGCACCCAAACACGCCGTCTCTTCGCCCTCGTCAAGAAAACAGCCCG
AAGCAGCGTCTCAGCCGCCCTAACCGCCGACAGAGCCAAGGCCGCAGCCGGCGCCCACCGAGCCCGAGACCGTCT
CGGCGTCGTCCGTCCATCTCCGGTCCCGGAAGTGGGCACCGTCGCCGGCCCCGTCCGCTTCCCCGCCCGGTACGA
CGGCCGGCGCGGTCACGCTTACGTCACGACGACGGCTACCGCCCCGGCTCTCAGCTGGAGGCCGAGCGGGGGTTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail