Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00459
Gene name
Locationscaffold_01:1852048..1853860
Strand-
Gene length (bp)1812
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.719 0.3397 0.1004 0.3616 0.2027 0.0359 0.1801 0.2632 0.1564 0.124

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1567
Ophiocordyceps australis map64 (Brazil) OphauB2|1332
Ophiocordyceps camponoti-floridani Ophcf2|00459 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1090
Ophiocordyceps kimflemingae Ophio5|1910
Ophiocordyceps subramaniannii Hirsu2|2313
Ophiocordyceps subramaniannii Hirsu2|2314

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00459
MSSLKLKPLLLPQLVQERRKLDGQTSSDVVDVSSTINSFESDVESPVTPIVSPRGLFHRLSSSSSSSPDLPPPPE
TPSSPTTQLFDKRLLPDVQEDPMERYEEDAMSFSSTSSEHFGLYSCLCDTPCQHRSSSEGLSPDDMMADFDLDYD
MGFMSDGDSAADPRQPPKKRAADNSSPFAGLTSRIGSRLPTIKRWRSNRRANAAVSSPLTDLSLENVFSRGPSSR
SSSLSASNQQTTPERLSEMPPAPSSSTTVSYFASSEDLSGSSLVDMTPEEQSNLERDRSMATTPLLPPLLTDPLG
KPPQESPLQSPTVAPTPAAATAAAAVPPASSPPPPPAPAGLSSPTPLSTRPSLKSLRQVSTATTVATSDMPLPLP
AILQEQDEWSDRLGHANFTITPLPYELETLSAETVGRFRDDWDAARVNYTKHLVRTGEHYGQTSKIYALTEAKWA
ETERRWKRFYDDMVRQGSRPALDSGNPSRSHSRGRGRGRSSSSVPVMGRLHSSDDVLADLDWRRMDDCLPSAVPR
MLESLDAQGKFPCRGDEDIVGPMQRAAVMARARSEDAKGHFWRSIADKVGFRK*
Coding >Ophcf2|00459
ATGTCGTCGCTGAAGCTCAAGCCTCTCCTGCTGCCGCAGCTCGTCCAGGAGCGCCGCAAACTCGACGGACAGACG
AGTTCCGATGTTGTCGACGTCTCGTCCACCATCAATTCCTTCGAGTCGGATGTCGAGTCGCCCGTGACGCCCATC
GTGTCGCCACGCGGTCTTTTTCATCGCCTTTCCAGCAGCTCTTCGTCGTCGCCAGATCTGCCGCCTCCCCCAGAG
ACGCCCTCGTCACCCACGACCCAGCTCTTTGACAAACGCCTGTTGCCCGACGTCCAGGAAGACCCGATGGAGCGC
TACGAGGAGGACGCCATGTCCTTCTCGTCGACTTCTTCAGAGCACTTTGGTCTCTACAGCTGTCTGTGCGATACG
CCATGCCAGCATCGCAGCAGCTCTGAAGGGCTGTCTCCAGACGACATGATGGCCGACTTTGACCTGGACTACGAC
ATGGGCTTCATGAGCGACGGCGATTCGGCCGCTGACCCTCGTCAACCTCCCAAGAAGCGCGCCGCCGACAATAGC
TCACCCTTTGCCGGCTTGACATCGCGCATCGGCTCACGTCTCCCCACCATCAAGCGCTGGAGGTCAAACAGGCGA
GCCAACGCCGCCGTCTCATCGCCCCTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGGCCGTCGAGCCGC
TCCTCGTCCCTGTCGGCTTCGAACCAACAGACGACGCCAGAACGCCTCTCCGAGATGCCCCCGGCCCCATCCAGC
TCCACCACAGTCTCCTACTTCGCCAGCTCCGAAGACCTGAGCGGCTCGTCGCTCGTCGACATGACGCCCGAGGAA
CAGTCCAACCTGGAACGCGACCGTTCCATGGCCACGACGCCCCTGTTACCCCCGCTCTTGACGGATCCGTTGGGC
AAGCCGCCTCAGGAGTCTCCCCTCCAGTCCCCGACGGTGGCGCCGACGCCCGCCGCCGCCACCGCCGCCGCCGCC
GTGCCTCCTGCGTCTTCCCCTCCGCCGCCGCCTGCGCCCGCGGGCTTGTCATCGCCGACACCGCTCAGCACTCGG
CCGTCGCTCAAGTCGCTGCGCCAGGTCTCGACGGCCACCACGGTGGCGACGTCAGACATGCCTCTACCGCTGCCC
GCGATCCTGCAGGAGCAAGACGAATGGTCAGATCGCCTGGGCCACGCAAACTTTACCATCACGCCCCTGCCGTAC
GAGCTCGAGACGCTGTCGGCCGAGACGGTTGGCCGCTTCCGCGACGACTGGGACGCGGCGCGCGTCAACTACACC
AAGCACCTGGTTCGCACCGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCC
GAGACGGAGCGTCGCTGGAAGCGTTTCTACGATGACATGGTCCGCCAGGGCAGCCGGCCGGCCCTCGACTCGGGT
AACCCATCGCGCAGCCACAGCCGGGGACGGGGCCGGGGTCGCTCCAGCAGCTCGGTGCCCGTCATGGGTCGCCTG
CACTCGAGCGACGACGTGCTGGCAGACCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGC
ATGCTAGAGTCGCTCGACGCCCAGGGCAAGTTCCCCTGTCGGGGCGACGAAGACATCGTCGGCCCCATGCAGCGG
GCGGCCGTCATGGCTCGAGCCCGCAGCGAGGACGCAAAAGGCCACTTCTGGCGGAGCATAGCCGACAAGGTGGGC
TTCCGCAAGTGA
Transcript >Ophcf2|00459
ATGTCGTCGCTGAAGCTCAAGCCTCTCCTGCTGCCGCAGCTCGTCCAGGAGCGCCGCAAACTCGACGGACAGACG
AGTTCCGATGTTGTCGACGTCTCGTCCACCATCAATTCCTTCGAGTCGGATGTCGAGTCGCCCGTGACGCCCATC
GTGTCGCCACGCGGTCTTTTTCATCGCCTTTCCAGCAGCTCTTCGTCGTCGCCAGATCTGCCGCCTCCCCCAGAG
ACGCCCTCGTCACCCACGACCCAGCTCTTTGACAAACGCCTGTTGCCCGACGTCCAGGAAGACCCGATGGAGCGC
TACGAGGAGGACGCCATGTCCTTCTCGTCGACTTCTTCAGAGCACTTTGGTCTCTACAGCTGTCTGTGCGATACG
CCATGCCAGCATCGCAGCAGCTCTGAAGGGCTGTCTCCAGACGACATGATGGCCGACTTTGACCTGGACTACGAC
ATGGGCTTCATGAGCGACGGCGATTCGGCCGCTGACCCTCGTCAACCTCCCAAGAAGCGCGCCGCCGACAATAGC
TCACCCTTTGCCGGCTTGACATCGCGCATCGGCTCACGTCTCCCCACCATCAAGCGCTGGAGGTCAAACAGGCGA
GCCAACGCCGCCGTCTCATCGCCCCTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGGCCGTCGAGCCGC
TCCTCGTCCCTGTCGGCTTCGAACCAACAGACGACGCCAGAACGCCTCTCCGAGATGCCCCCGGCCCCATCCAGC
TCCACCACAGTCTCCTACTTCGCCAGCTCCGAAGACCTGAGCGGCTCGTCGCTCGTCGACATGACGCCCGAGGAA
CAGTCCAACCTGGAACGCGACCGTTCCATGGCCACGACGCCCCTGTTACCCCCGCTCTTGACGGATCCGTTGGGC
AAGCCGCCTCAGGAGTCTCCCCTCCAGTCCCCGACGGTGGCGCCGACGCCCGCCGCCGCCACCGCCGCCGCCGCC
GTGCCTCCTGCGTCTTCCCCTCCGCCGCCGCCTGCGCCCGCGGGCTTGTCATCGCCGACACCGCTCAGCACTCGG
CCGTCGCTCAAGTCGCTGCGCCAGGTCTCGACGGCCACCACGGTGGCGACGTCAGACATGCCTCTACCGCTGCCC
GCGATCCTGCAGGAGCAAGACGAATGGTCAGATCGCCTGGGCCACGCAAACTTTACCATCACGCCCCTGCCGTAC
GAGCTCGAGACGCTGTCGGCCGAGACGGTTGGCCGCTTCCGCGACGACTGGGACGCGGCGCGCGTCAACTACACC
AAGCACCTGGTTCGCACCGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCC
GAGACGGAGCGTCGCTGGAAGCGTTTCTACGATGACATGGTCCGCCAGGGCAGCCGGCCGGCCCTCGACTCGGGT
AACCCATCGCGCAGCCACAGCCGGGGACGGGGCCGGGGTCGCTCCAGCAGCTCGGTGCCCGTCATGGGTCGCCTG
CACTCGAGCGACGACGTGCTGGCAGACCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGC
ATGCTAGAGTCGCTCGACGCCCAGGGCAAGTTCCCCTGTCGGGGCGACGAAGACATCGTCGGCCCCATGCAGCGG
GCGGCCGTCATGGCTCGAGCCCGCAGCGAGGACGCAAAAGGCCACTTCTGGCGGAGCATAGCCGACAAGGTGGGC
TTCCGCAAGTGA
Gene >Ophcf2|00459
ATGTCGTCGCTGAAGCTCAAGCCTCTCCTGCTGCCGCAGCTCGTCCAGGAGCGCCGCAAACTCGACGGACAGACG
AGTTCCGATGTTGTCGACGTCTCGTCCACCATCAATTCCTTCGAGTCGGATGTCGAGTCGCCCGTGACGCCCATC
GTGTCGCCACGCGGTCTTTTTCATCGCCTTTCCAGCAGCTCTTCGTCGTCGCCAGATCTGCCGCCTCCCCCAGAG
ACGCCCTCGTCACCCACGACCCAGCTCTTTGACAAACGCCTGTTGCCCGACGTCCAGGAAGACCCGATGGAGCGC
TACGAGGAGGACGCCATGTCCTTCTCGTCGACTTCTTCAGAGCACTTTGGTCTCTACAGCTGTCTGTGTAAGTCG
TCGACCGCTCAGAACACACCCCTGTTTCGTCTACCTGCTGACGGTGGTGGGGTGGAAAAAAAAATAGGCGATACG
CCATGCCAGCATCGCAGCAGCTCTGAAGGGCTGTCTCCAGACGACATGATGGCCGACTTTGACCTGGACTACGAC
ATGGGCTTCATGAGCGACGGCGATTCGGCCGCTGACCCTCGTCAACCTCCCAAGAAGCGCGCCGCCGACAATAGC
TCACCCTTTGCCGGCTTGACATCGCGCATCGGCTCACGTCTCCCCACCATCAAGCGCTGGAGGTCAAACAGGCGA
GCCAACGCCGCCGTCTCATCGCCCCTAACCGATCTGAGCCTGGAAAACGTGTTCTCGCGCGGGCCGTCGAGCCGC
TCCTCGTCCCTGTCGGCTTCGAACCAACAGACGACGCCAGAACGCCTCTCCGAGATGCCCCCGGCCCCATCCAGC
TCCACCACAGTCTCCTACTTCGCCAGCTCCGAAGACCTGAGCGGCTCGTCGCTCGTCGACATGACGCCCGAGGAA
CAGTCCAACCTGGAACGCGACCGTTCCATGGCCACGACGCCCCTGTTACCCCCGCTCTTGACGGATCCGTTGGGC
AAGCCGCCTCAGGAGTCTCCCCTCCAGTCCCCGACGGTGGCGCCGACGCCCGCCGCCGCCACCGCCGCCGCCGCC
GTGCCTCCTGCGTCTTCCCCTCCGCCGCCGCCTGCGCCCGCGGGCTTGTCATCGCCGACACCGCTCAGCACTCGG
CCGTCGCTCAAGTCGCTGCGCCAGGTCTCGACGGCCACCACGGTGGCGACGTCAGACATGCCTCTACCGCTGCCC
GCGATCCTGCAGGAGCAAGACGAATGGTCAGATCGCCTGGGCCACGCAAACTTTACCATCACGCCCCTGCCGTAC
GAGCTCGAGACGCTGTCGGCCGAGACGGTTGGCCGCTTCCGCGACGACTGGGACGCGGCGCGCGTCAACTACACC
AAGCACCTGGTTCGCACCGGCGAGCACTACGGCCAGACGAGCAAGATCTACGCCCTGACCGAGGCCAAGTGGGCC
GAGACGGAGCGTCGCTGGAAGCGTTTCTACGATGACATGGTCCGCCAGGGCAGCCGGCCGGCCCTCGACTCGGGT
AACCCATCGCGCAGCCACAGCCGGGGACGGGGCCGGGGTCGCTCCAGCAGCTCGGTGCCCGTCATGGGTCGCCTG
CACTCGAGCGACGACGTGCTGGCAGACCTCGACTGGCGACGCATGGACGACTGCCTCCCCAGCGCCGTGCCGCGC
ATGCTAGAGTCGCTCGACGCCCAGGGCAAGTTCCCCTGTCGGGGCGACGAAGACATCGTCGGCCCCATGCAGCGG
GCGGCCGTCATGGCTCGAGCCCGCAGCGAGGACGCAAAAGGCCACTTCTGGCGGAGCATAGCCGACAAGGTGGGC
TTCCGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail