Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00455
Gene name
Locationscaffold_01:1839713..1840628
Strand-
Gene length (bp)915
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 5.3E-20 85 281

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 151 173 22
3 225 247 22
4 251 273 22
5 280 299 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00455
MNRKHVLGARYHAYSIWLFTRSDIKDIILPSLLYSLVTLPSLPPVFSITTPPLSLFQRLPLALFWTWINLVPITI
DNQRQPDSIAEDAINKPWRTLPSRRMTPRDATTLMIFLYPLALLSSLFTGGFLQSLSLIVLSFWYNNLRGAQDNL
MTRQVLNAAGFNCFATGALTVLVGRASPLTTGPFLTWQLMLIAVVATTVQTQDMYDQEGDAERGRHTVPLDLGDG
FARWTVAVAVVFWSVLCPCFVGGHVLGFFLTGCLGFVVALRCLLLRSVAADKRSYIVWNVWLVSVYSLPLLAAVS
EGSI*
Coding >Ophcf2|00455
ATGAATCGAAAACACGTTCTTGGAGCCCGCTATCACGCCTACTCCATATGGCTCTTCACTCGTAGCGACATCAAG
GACATCATCCTCCCCAGCCTTCTCTACTCCCTCGTCACCCTACCCTCCCTCCCTCCCGTCTTCAGCATCACCACG
CCTCCGCTATCCCTCTTCCAAAGACTCCCCCTCGCCCTCTTCTGGACGTGGATCAACCTTGTACCCATCACCATC
GACAACCAACGCCAGCCAGACTCTATAGCCGAAGACGCCATCAACAAGCCATGGCGTACGCTCCCCTCCCGACGC
ATGACTCCTCGCGATGCCACCACCCTCATGATCTTCCTCTACCCCCTCGCCCTACTATCCAGCCTGTTCACTGGC
GGCTTCCTGCAAAGCCTCTCCCTCATCGTCCTCAGCTTCTGGTACAACAACCTCCGAGGTGCTCAGGACAACTTG
ATGACGCGTCAGGTCCTCAACGCCGCGGGCTTCAACTGCTTCGCCACAGGCGCCCTCACCGTCCTCGTGGGCAGA
GCAAGCCCGCTGACAACCGGTCCCTTTCTCACCTGGCAACTGATGCTGATAGCCGTGGTAGCGACGACAGTTCAG
ACGCAGGACATGTACGATCAGGAGGGGGACGCTGAGCGCGGCCGCCACACGGTCCCCTTGGATTTGGGCGACGGC
TTCGCTCGCTGGACTGTTGCCGTGGCTGTTGTCTTTTGGTCGGTGCTTTGTCCTTGTTTTGTTGGGGGGCATGTG
CTGGGCTTCTTCTTGACGGGCTGCTTGGGCTTTGTTGTTGCCCTTCGCTGTCTGTTACTGAGGAGTGTGGCGGCT
GATAAGAGGAGCTATATTGTTTGGAACGTTTGGTTGGTTTCTGTCTATTCGCTGCCCCTGCTTGCGGCTGTCTCG
GAGGGAAGTATATGA
Transcript >Ophcf2|00455
ATGAATCGAAAACACGTTCTTGGAGCCCGCTATCACGCCTACTCCATATGGCTCTTCACTCGTAGCGACATCAAG
GACATCATCCTCCCCAGCCTTCTCTACTCCCTCGTCACCCTACCCTCCCTCCCTCCCGTCTTCAGCATCACCACG
CCTCCGCTATCCCTCTTCCAAAGACTCCCCCTCGCCCTCTTCTGGACGTGGATCAACCTTGTACCCATCACCATC
GACAACCAACGCCAGCCAGACTCTATAGCCGAAGACGCCATCAACAAGCCATGGCGTACGCTCCCCTCCCGACGC
ATGACTCCTCGCGATGCCACCACCCTCATGATCTTCCTCTACCCCCTCGCCCTACTATCCAGCCTGTTCACTGGC
GGCTTCCTGCAAAGCCTCTCCCTCATCGTCCTCAGCTTCTGGTACAACAACCTCCGAGGTGCTCAGGACAACTTG
ATGACGCGTCAGGTCCTCAACGCCGCGGGCTTCAACTGCTTCGCCACAGGCGCCCTCACCGTCCTCGTGGGCAGA
GCAAGCCCGCTGACAACCGGTCCCTTTCTCACCTGGCAACTGATGCTGATAGCCGTGGTAGCGACGACAGTTCAG
ACGCAGGACATGTACGATCAGGAGGGGGACGCTGAGCGCGGCCGCCACACGGTCCCCTTGGATTTGGGCGACGGC
TTCGCTCGCTGGACTGTTGCCGTGGCTGTTGTCTTTTGGTCGGTGCTTTGTCCTTGTTTTGTTGGGGGGCATGTG
CTGGGCTTCTTCTTGACGGGCTGCTTGGGCTTTGTTGTTGCCCTTCGCTGTCTGTTACTGAGGAGTGTGGCGGCT
GATAAGAGGAGCTATATTGTTTGGAACGTTTGGTTGGTTTCTGTCTATTCGCTGCCCCTGCTTGCGGCTGTCTCG
GAGGGAAGTATATGA
Gene >Ophcf2|00455
ATGAATCGAAAACACGTTCTTGGAGCCCGCTATCACGCCTACTCCATATGGCTCTTCACTCGTAGCGACATCAAG
GACATCATCCTCCCCAGCCTTCTCTACTCCCTCGTCACCCTACCCTCCCTCCCTCCCGTCTTCAGCATCACCACG
CCTCCGCTATCCCTCTTCCAAAGACTCCCCCTCGCCCTCTTCTGGACGTGGATCAACCTTGTACCCATCACCATC
GACAACCAACGCCAGCCAGACTCTATAGCCGAAGACGCCATCAACAAGCCATGGCGTACGCTCCCCTCCCGACGC
ATGACTCCTCGCGATGCCACCACCCTCATGATCTTCCTCTACCCCCTCGCCCTACTATCCAGCCTGTTCACTGGC
GGCTTCCTGCAAAGCCTCTCCCTCATCGTCCTCAGCTTCTGGTACAACAACCTCCGAGGTGCTCAGGACAACTTG
ATGACGCGTCAGGTCCTCAACGCCGCGGGCTTCAACTGCTTCGCCACAGGCGCCCTCACCGTCCTCGTGGGCAGA
GCAAGCCCGCTGACAACCGGTCCCTTTCTCACCTGGCAACTGATGCTGATAGCCGTGGTAGCGACGACAGTTCAG
ACGCAGGACATGTACGATCAGGAGGGGGACGCTGAGCGCGGCCGCCACACGGTCCCCTTGGATTTGGGCGACGGC
TTCGCTCGCTGGACTGTTGCCGTGGCTGTTGTCTTTTGGTCGGTGCTTTGTCCTTGTTTTGTTGGGGGGCATGTG
CTGGGCTTCTTCTTGACGGGCTGCTTGGGCTTTGTTGTTGCCCTTCGCTGTCTGTTACTGAGGAGTGTGGCGGCT
GATAAGAGGAGCTATATTGTTTGGAACGTTTGGTTGGTTTCTGTCTATTCGCTGCCCCTGCTTGCGGCTGTCTCG
GAGGGAAGTATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail