Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00443
Gene name
Locationscaffold_01:1807537..1809706
Strand-
Gene length (bp)2169
Transcript length (bp)1983
Coding sequence length (bp)1983
Protein length (aa) 661

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00995 Sec1 Sec1 family 8.8E-127 31 643

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 597 619 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 56.56 32.56 80.57
Alive In ants, during behavior modification 56.59 31.88 81.30
Dead In ants, recently dead 53.89 30.96 76.81

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.998183 no
Alive Dead 0.808649 no
Dead Fungus 0.831484 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00443
MAPRTEFSSEQVRGKARKDFLYLLEGVRGKKNLVFDRSLVGPIGTIVKVTTLQEYGVDKFFILENDNVDSSQHNI
VFVARGECGRHPETIAAQIKRVQRESQTSHDFHIFWVPRRTLVADQLLEEAGVLGDVSISELPFFFFPLERDVLS
LELDDSFHDLYLSKDVTPNYLLARALMQVQHNHGLFPRIIGKGDNAKRVADLLCRLRQEALAGEDASDVGKTGLT
PSTTIESVIIIDRQVDFVTPLLTQLTYEGLIDEVFGIQNNQAKVDTAVVGAPAQSSAAATSSQSRKRTIQLDSSD
KLYEQLRDANFAIVGGLLNKVARRLQQVHSDYESKQKTKTLAELKEFVGRLPGYQQEHQSARIHTGLAEDIIKHT
RSDQFKGLLEVQQNLAAGADPSSQFDEIEELIAREAPLRETLRLLCIYSCISEGVKPKEYDNFRRLILHGYGYQH
ILTLNKLEKLQLFVSRSSPLAGVMSLTGGASASGSKTNYAILRKQLRLIVDEVQEDDPNDISYVYSGYAPLSIRL
VQCVLQKQQLLSMTKGNGVSGASASSTAATQGWHGFDEAVRHVRGQTFYEIQKGEDKAVKARALLAGSGQKQTVF
VVLVGGITFTEIAALRFLAKQEQERRNIVICTTSIISGNRMMDAAIEKESFASQGVDASG*
Coding >Ophcf2|00443
ATGGCGCCTCGCACCGAGTTCAGCTCCGAGCAGGTCCGCGGAAAGGCTCGAAAGGACTTTCTCTACCTGCTCGAG
GGTGTCCGCGGCAAGAAGAACCTCGTGTTTGATCGCAGCCTCGTCGGGCCCATTGGGACCATCGTCAAGGTCACG
ACGCTTCAGGAGTATGGCGTCGACAAGTTCTTTATCCTCGAAAACGACAATGTCGACTCGAGCCAGCACAATATC
GTCTTTGTCGCTCGGGGCGAATGTGGCCGCCACCCCGAGACCATAGCGGCCCAGATCAAGCGAGTGCAGCGCGAG
AGTCAGACTAGTCATGACTTTCACATCTTCTGGGTCCCGCGCCGGACCCTTGTCGCCGACCAGCTGCTCGAGGAG
GCCGGTGTGCTCGGCGACGTGAGCATCTCGGAGCTTCCCTTCTTCTTCTTTCCGCTCGAAAGGGACGTTTTATCT
CTAGAGCTCGACGACTCCTTTCACGACCTCTATCTATCCAAGGACGTCACACCCAACTACTTGCTGGCCCGAGCT
CTGATGCAGGTTCAGCACAATCACGGCCTCTTCCCTCGTATCATCGGCAAGGGCGACAACGCCAAAAGAGTGGCC
GACCTGCTATGTCGTCTGCGTCAGGAGGCTCTAGCCGGCGAGGACGCGTCTGACGTGGGCAAGACGGGCCTCACG
CCGAGTACGACCATTGAGAGCGTCATCATCATCGATCGCCAAGTTGACTTTGTCACTCCGCTGCTAACACAGCTG
ACGTACGAGGGTCTCATCGATGAAGTCTTTGGCATCCAGAATAATCAGGCCAAGGTCGATACGGCCGTGGTCGGC
GCACCGGCTCAGTCATCGGCAGCCGCCACATCGTCGCAGAGTCGCAAACGAACCATTCAACTCGACTCTTCCGAC
AAGCTGTACGAGCAGCTGCGAGATGCAAACTTTGCCATCGTTGGGGGGCTGCTCAACAAGGTCGCCCGCCGGCTG
CAGCAAGTCCACAGCGACTACGAGAGCAAGCAAAAGACCAAGACGCTGGCCGAACTCAAAGAGTTCGTCGGACGG
CTACCAGGCTACCAACAAGAGCACCAGAGCGCCAGAATTCACACCGGGCTGGCCGAGGACATCATCAAGCACACT
CGCTCTGATCAGTTCAAAGGCCTTCTCGAGGTTCAGCAGAACCTCGCCGCGGGCGCAGACCCATCGTCCCAGTTC
GATGAAATAGAGGAGCTCATCGCGCGTGAGGCGCCGCTGCGGGAGACGCTGAGGCTGCTGTGCATCTACTCGTGC
ATTTCCGAAGGAGTGAAGCCCAAGGAGTACGATAATTTCCGACGTCTGATCCTGCATGGCTACGGCTACCAGCAC
ATCCTCACGCTCAACAAGCTCGAGAAGCTTCAGCTCTTCGTATCGCGCTCGTCGCCGCTCGCTGGCGTAATGTCC
CTGACTGGTGGTGCATCCGCCTCCGGGAGCAAGACTAATTACGCAATTCTGCGGAAGCAACTCCGCCTCATCGTG
GATGAGGTGCAGGAAGACGATCCAAACGATATATCATATGTGTACAGCGGATACGCGCCGCTTTCGATTCGGCTA
GTGCAATGCGTACTGCAAAAGCAGCAACTCTTGTCCATGACCAAAGGCAACGGAGTCTCCGGCGCCAGCGCCTCG
TCCACGGCTGCCACACAGGGCTGGCATGGCTTCGACGAAGCTGTCAGGCACGTCCGCGGTCAGACCTTTTATGAG
ATTCAGAAAGGCGAGGACAAGGCCGTCAAGGCGAGAGCGTTGCTGGCGGGCAGCGGTCAGAAGCAAACCGTTTTC
GTCGTCTTGGTGGGCGGTATCACCTTTACGGAGATTGCCGCGCTCCGATTCCTGGCCAAGCAGGAACAAGAACGC
CGAAATATTGTCATATGTACGACATCCATCATCAGCGGGAACCGGATGATGGACGCGGCCATCGAGAAGGAGTCG
TTTGCGTCTCAAGGCGTCGATGCCTCTGGCTGA
Transcript >Ophcf2|00443
ATGGCGCCTCGCACCGAGTTCAGCTCCGAGCAGGTCCGCGGAAAGGCTCGAAAGGACTTTCTCTACCTGCTCGAG
GGTGTCCGCGGCAAGAAGAACCTCGTGTTTGATCGCAGCCTCGTCGGGCCCATTGGGACCATCGTCAAGGTCACG
ACGCTTCAGGAGTATGGCGTCGACAAGTTCTTTATCCTCGAAAACGACAATGTCGACTCGAGCCAGCACAATATC
GTCTTTGTCGCTCGGGGCGAATGTGGCCGCCACCCCGAGACCATAGCGGCCCAGATCAAGCGAGTGCAGCGCGAG
AGTCAGACTAGTCATGACTTTCACATCTTCTGGGTCCCGCGCCGGACCCTTGTCGCCGACCAGCTGCTCGAGGAG
GCCGGTGTGCTCGGCGACGTGAGCATCTCGGAGCTTCCCTTCTTCTTCTTTCCGCTCGAAAGGGACGTTTTATCT
CTAGAGCTCGACGACTCCTTTCACGACCTCTATCTATCCAAGGACGTCACACCCAACTACTTGCTGGCCCGAGCT
CTGATGCAGGTTCAGCACAATCACGGCCTCTTCCCTCGTATCATCGGCAAGGGCGACAACGCCAAAAGAGTGGCC
GACCTGCTATGTCGTCTGCGTCAGGAGGCTCTAGCCGGCGAGGACGCGTCTGACGTGGGCAAGACGGGCCTCACG
CCGAGTACGACCATTGAGAGCGTCATCATCATCGATCGCCAAGTTGACTTTGTCACTCCGCTGCTAACACAGCTG
ACGTACGAGGGTCTCATCGATGAAGTCTTTGGCATCCAGAATAATCAGGCCAAGGTCGATACGGCCGTGGTCGGC
GCACCGGCTCAGTCATCGGCAGCCGCCACATCGTCGCAGAGTCGCAAACGAACCATTCAACTCGACTCTTCCGAC
AAGCTGTACGAGCAGCTGCGAGATGCAAACTTTGCCATCGTTGGGGGGCTGCTCAACAAGGTCGCCCGCCGGCTG
CAGCAAGTCCACAGCGACTACGAGAGCAAGCAAAAGACCAAGACGCTGGCCGAACTCAAAGAGTTCGTCGGACGG
CTACCAGGCTACCAACAAGAGCACCAGAGCGCCAGAATTCACACCGGGCTGGCCGAGGACATCATCAAGCACACT
CGCTCTGATCAGTTCAAAGGCCTTCTCGAGGTTCAGCAGAACCTCGCCGCGGGCGCAGACCCATCGTCCCAGTTC
GATGAAATAGAGGAGCTCATCGCGCGTGAGGCGCCGCTGCGGGAGACGCTGAGGCTGCTGTGCATCTACTCGTGC
ATTTCCGAAGGAGTGAAGCCCAAGGAGTACGATAATTTCCGACGTCTGATCCTGCATGGCTACGGCTACCAGCAC
ATCCTCACGCTCAACAAGCTCGAGAAGCTTCAGCTCTTCGTATCGCGCTCGTCGCCGCTCGCTGGCGTAATGTCC
CTGACTGGTGGTGCATCCGCCTCCGGGAGCAAGACTAATTACGCAATTCTGCGGAAGCAACTCCGCCTCATCGTG
GATGAGGTGCAGGAAGACGATCCAAACGATATATCATATGTGTACAGCGGATACGCGCCGCTTTCGATTCGGCTA
GTGCAATGCGTACTGCAAAAGCAGCAACTCTTGTCCATGACCAAAGGCAACGGAGTCTCCGGCGCCAGCGCCTCG
TCCACGGCTGCCACACAGGGCTGGCATGGCTTCGACGAAGCTGTCAGGCACGTCCGCGGTCAGACCTTTTATGAG
ATTCAGAAAGGCGAGGACAAGGCCGTCAAGGCGAGAGCGTTGCTGGCGGGCAGCGGTCAGAAGCAAACCGTTTTC
GTCGTCTTGGTGGGCGGTATCACCTTTACGGAGATTGCCGCGCTCCGATTCCTGGCCAAGCAGGAACAAGAACGC
CGAAATATTGTCATATGTACGACATCCATCATCAGCGGGAACCGGATGATGGACGCGGCCATCGAGAAGGAGTCG
TTTGCGTCTCAAGGCGTCGATGCCTCTGGCTGA
Gene >Ophcf2|00443
ATGGCGCCTCGCACCGAGTTCAGCTCCGAGCAGGTCCGCGGAAAGGCTCGAAAGGACTTTCTCTACCTGCTCGAG
GGTGTAAGTGAGGCTCACGGCTGTCTCGCGTCCTCCAGTCCGCTGATGGCTTCAGCTCGCAGGTCCGCGGCAAGA
AGAACCTCGTGTTTGATCGCAGCCTCGTCGGGCCCATTGGGACCATCGTCAAGGTCACGACGCTTCAGGAGTATG
GCGTCGACAAGTTCTTTATCCTCGAAAACGACAATGTCGACTCGAGCCAGCACAATATCGTCTTTGTCGCTCGGG
GCGAATGTGGCCGCCACCCCGAGACCATAGCGGGTATGTATCACGGCCCTGTGAGCCGTCTGGCGGTATCAGAAT
CAGACTGACGGTCAACGCTTCTGACCTAGCCCAGATCAAGCGAGTGCAGCGCGAGAGTCAGACTAGTCATGACTT
TCACATCTTCTGGGTCCCGCGCCGGACCCTTGTCGCCGACCAGCTGCTCGAGGAGGCCGGTGTGCTCGGCGACGT
GAGCATCTCGGAGCTTCCCTTCTTCTTCTTTCCGCTCGAAAGGGACGTTTTATCTCTAGAGCTCGACGACTCCTT
TCACGACCTCTATCTATCCAAGGACGTCACACCCAACTACTTGCTGGCCCGAGCTCTGATGCAGGTTCAGCACAA
TCACGGCCTCTTCCCTCGTATCATCGGCAAGGGCGACAACGCCAAAAGAGTGGCCGACCTGCTATGTCGTCTGCG
TCAGGAGGCTCTAGCCGGCGAGGACGCGTCTGACGTGGGCAAGACGGGCCTCACGCCGAGTACGACCATTGAGAG
CGTCATCATCATCGATCGCCAAGTTGACTTTGTCACTCCGCTGCTAACACAGCTGACGTACGAGGGTCTCATCGA
TGAAGTCTTTGGCATCCAGAATAATCAGGCCAAGGTCGATACGGCCGTGGTCGGCGCACCGGCTCAGTCATCGGC
AGCCGCCACATCGTCGCAGAGTCGCAAACGAACCATTCAACTCGACTCTTCCGACAAGCTGTACGAGCAGCTGCG
AGATGCAAACTTTGCCATCGTTGGGGGGCTGCTCAACAAGGTCGCCCGCCGGCTGCAGCAAGTCCACAGCGACTA
CGAGAGCAAGCAAAAGACCAAGACGCTGGCCGAACTCAAAGAGTTCGTCGGACGGCTACCAGGCTACCAACAAGA
GCACCAGAGCGCCAGAATTCACACCGGGCTGGCCGAGGACATCATCAAGCACACTCGCTCTGATCAGTTCAAAGG
CCTTCTCGAGGTTCAGCAGAACCTCGCCGCGGGCGCAGACCCATCGTCCCAGTTCGATGAAATAGAGGAGCTCAT
CGCGCGTGAGGCGCCGCTGCGGGAGACGCTGAGGCTGCTGTGCATCTACTCGTGCATTTCCGAAGGAGTGAAGCC
CAAGGAGTACGATAATTTCCGACGTCTGATCCTGCATGGCTACGGCTACCAGCACATCCTCACGCTCAACAAGCT
CGAGAAGCTTCAGCTCTTCGTATCGCGCTCGTCGCCGCTCGCTGGCGTAATGTCCCTGACTGGTGGTGCATCCGC
CTCCGGGAGCAAGACTAATTACGCAATTCTGCGGAAGCAACTCCGCCTCATCGTGGATGAGGTGCAGGAAGACGA
TCCAAACGATATATCATATGTGTACAGCGGATACGCGCCGCTTTCGATTCGGCTAGTGCAATGCGTACTGCAAAA
GCAGCAACTCTTGTCCATGACCAAAGGCAACGGAGTCTCCGGCGCCAGCGCCTCGTCCACGGCTGCCACACAGGG
CTGGCATGGCTTCGACGAAGCTGTCAGGCACGTCCGCGGTCAGACCTTTTATGAGATTCAGAAAGGCGAGGACAA
GGCCGTCAAGGCGAGAGCGTTGCTGGCGGGCAGCGGTCAGAAGCAAACCGTTTTCGTCGTCTTGGTGGGCGGTAT
CACCTTTACGGAGATTGCCGCGCTCCGATTCCTGGCCAAGCAGGAACAAGGTAAGCAGATGGTCGGCTTCCGGTC
GTCCAGGATTTCCGCTCTGACTGAAGAATAGAACGCCGAAATATTGTCATATGTACGACATCCATCATCAGCGGG
AACCGGATGATGGACGCGGCCATCGAGAAGGAGTCGTTTGCGTCTCAAGGCGTCGATGCCTCTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail