Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00442
Gene name
Locationscaffold_01:1803535..1807051
Strand-
Gene length (bp)3516
Transcript length (bp)3312
Coding sequence length (bp)3312
Protein length (aa) 1104

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 5.0E-82 358 920
PF04433 SWIRM SWIRM domain 1.2E-11 250 327
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.4E-08 353 415
PF09011 HMG_box_2 HMG-box domain 5.1E-08 980 1052
PF00505 HMG_box HMG (high mobility group) box 1.3E-06 983 1055

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005515 protein binding Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4419 0.6841 0.1204 0.0349 0.2075 0.0376 0.0593 0.0515 0.2012 0.0778

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4722
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4301
Ophiocordyceps australis map64 (Brazil) OphauB2|6346
Ophiocordyceps camponoti-floridani Ophcf2|00442 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3447
Ophiocordyceps kimflemingae Ophio5|4733
Ophiocordyceps subramaniannii Hirsu2|9946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00442
MRHESSAEPVDQRGIGDCSTAHWQMADMETTVSGLFQGLNESDDAESVSSSRSIHVSLLASAAASTVRAPCLDSS
SPESRQEPSDASRSPRSVVWSASDKPGDMDSKASPTVKAGSNDPAPQPQSEEPTLPASCDKNDATGSFASSLSVL
TEMSDLSSPPSSEYSKATTPAEADTTRTQQNEDHLKQGEMRDEQRPRPGDDHGQQPSKPSSYYHNIERLSFTIRP
KSSIPADMSLEQYAGECIDAAECSRLNPYALHPEEYILLRHHISHAQVTTYLNIRNGILRLWMLRPWIGVAREDA
VACANTRWFDAASVCYDWLVRRGYINFGCVQIPDVVSEKADSPRVKRRKTVAVIGAGISGLACARQLEGLFKQYA
QWHRENGDEVPRVVVLEGRARVGGRVYSREFKSRSVDQQPTRHTAEMGGMIITGFERGNPMNVLVRGQLGLPYHP
LTADTTIYDSNGKPVDAVRDQLVEKLYNDCLDRVSEFKFKPQPAKLIEGNRLLLAEGRDGVADGNKTVMQAEEAA
AALPHAAPVSQQNVPDKVNLVPVSADKLTGRVHTEPGVPATLRAADKAKLMGWNLRSGASGDFNIDLGKAASLPG
ATLGSVLDEAISQYRNLVDLSAQDHRLINWHVANLEYSNANSLRNLSLELWDMDAGNEWEGQHTMVVGGYQAVAR
GLLQCPTRLDLTTKFPVKSIKYHADGFDGTATIESESGETVEADCVICTVPLGVLKQSSITFDPPLPPWKTGVID
RLGFGILNKVVLVYDDVFWDPDRHIFGVLRDAPNRHSTAQKDYGANRGRFFQWFNVSNTTGLPCLIALTGCETEH
TSNDQLVAEATDILRSIFGDDVPYPKEAVVTRWGSDRFARGSYSSAASGMLPDDYDTMSRPLGNLFFAGEHTIGT
HPATVHGAYLSGLRAANEVLEAMIGPIEVPTPFVLPRDSLLLHKRKQAAEDPRQARLEAYEAEIWDHVRSQIGER
PARPSKAAANAYLIFSKQKLDEARRRCEESRKAGKARNGSSEVRVMLSRMWKDATPDERRPFELQAAEQKVTYTE
AMRVFSEQSQKWDREAAALRTAYERDHPSVPGPHEPAHDETPQKHRRVKLAGG*
Coding >Ophcf2|00442
ATGAGACACGAGAGCTCTGCAGAGCCGGTTGATCAAAGGGGGATCGGCGATTGTTCGACGGCACATTGGCAGATG
GCGGATATGGAGACGACAGTCAGCGGCCTCTTCCAAGGCCTCAATGAAAGCGACGATGCCGAATCGGTGTCATCG
TCGAGGTCTATACACGTTTCTCTCTTAGCAAGCGCTGCGGCGTCGACGGTCCGAGCTCCTTGCCTCGACAGTTCC
TCACCTGAATCGCGGCAAGAGCCTTCAGATGCGTCACGGTCACCCCGAAGCGTTGTCTGGTCAGCGTCAGACAAA
CCCGGAGACATGGATTCGAAAGCATCTCCTACTGTGAAGGCTGGCTCCAATGACCCAGCGCCTCAACCGCAAAGT
GAAGAGCCCACTCTGCCTGCGTCTTGCGACAAGAACGATGCCACCGGCTCGTTTGCTTCATCCCTCTCGGTTCTC
ACGGAGATGTCAGATTTATCGTCTCCGCCTTCGAGTGAATATAGCAAGGCTACTACCCCTGCCGAGGCGGACACG
ACGCGCACACAGCAAAACGAGGACCACCTCAAGCAGGGTGAAATGAGAGACGAGCAACGGCCCCGGCCGGGCGAC
GATCACGGCCAGCAGCCGAGTAAGCCGTCGTCGTATTACCATAACATCGAACGCCTAAGCTTTACCATCCGGCCC
AAGTCGTCCATCCCCGCCGACATGTCATTGGAGCAGTACGCCGGCGAGTGCATCGACGCGGCTGAATGTTCGCGG
CTCAATCCCTACGCACTCCACCCCGAGGAATATATTCTTCTTCGACACCACATATCACACGCCCAAGTCACGACA
TATCTCAACATCAGAAACGGCATCCTCCGTCTGTGGATGCTGCGCCCCTGGATTGGCGTCGCACGGGAAGACGCC
GTCGCCTGTGCTAATACCCGATGGTTCGACGCTGCGAGCGTCTGTTACGATTGGCTGGTCCGTCGCGGCTACATC
AACTTTGGCTGCGTGCAGATTCCGGACGTCGTCAGCGAGAAAGCAGATTCGCCACGAGTGAAGAGAAGGAAGACG
GTCGCCGTCATCGGCGCCGGCATCTCCGGCCTGGCCTGCGCGAGGCAGCTTGAAGGCCTGTTCAAGCAGTACGCC
CAATGGCATCGCGAGAATGGGGATGAGGTCCCCCGGGTGGTGGTGCTGGAGGGCAGGGCTCGTGTAGGGGGCAGA
GTGTACTCTCGCGAGTTCAAGAGCAGGTCTGTTGATCAGCAGCCGACGAGACACACGGCCGAGATGGGAGGCATG
ATCATCACGGGCTTCGAACGCGGAAACCCGATGAACGTGCTGGTACGCGGACAGCTCGGACTGCCCTACCACCCG
CTGACGGCAGACACGACGATATACGACAGCAACGGCAAGCCGGTAGACGCCGTCCGTGATCAGCTGGTCGAGAAG
CTCTACAACGACTGCCTGGACCGGGTGAGCGAGTTCAAGTTCAAGCCTCAGCCGGCCAAACTGATCGAGGGCAAC
CGTCTCCTGCTGGCCGAGGGCCGCGACGGCGTCGCCGACGGCAACAAGACGGTCATGCAGGCTGAGGAAGCGGCC
GCTGCCCTGCCTCACGCAGCTCCCGTTTCGCAGCAGAACGTCCCGGACAAGGTCAACCTGGTACCCGTATCGGCC
GACAAGCTGACGGGCCGCGTTCATACGGAGCCGGGCGTGCCGGCGACGCTGAGGGCTGCCGACAAGGCCAAGCTG
ATGGGCTGGAACCTGCGGTCTGGGGCTTCTGGCGACTTCAACATCGACCTCGGAAAGGCGGCCTCTCTACCGGGC
GCCACGCTGGGGTCCGTCCTGGACGAGGCCATATCACAGTACAGGAACTTGGTTGACCTGAGCGCGCAGGACCAC
CGGCTCATCAACTGGCATGTGGCCAATCTCGAGTACAGCAACGCCAACAGCCTGCGCAACTTGAGCCTCGAGCTG
TGGGACATGGACGCCGGAAACGAGTGGGAGGGCCAGCACACCATGGTGGTCGGGGGCTACCAGGCCGTCGCCCGC
GGCCTGCTGCAGTGTCCGACCAGGCTGGATCTGACGACCAAGTTCCCCGTCAAGAGTATCAAGTATCATGCAGAC
GGCTTCGACGGAACGGCCACGATCGAGTCTGAGAGCGGAGAGACTGTCGAGGCCGACTGCGTCATTTGCACCGTC
CCGCTCGGCGTCCTGAAGCAGAGCAGCATCACCTTCGATCCGCCGCTGCCGCCGTGGAAGACGGGCGTCATCGAC
AGGCTCGGCTTCGGCATACTGAACAAGGTGGTTCTGGTCTACGACGACGTCTTCTGGGACCCCGACAGACACATC
TTTGGCGTGCTCCGGGACGCGCCCAACCGACACAGCACGGCGCAGAAGGACTATGGCGCCAACAGGGGCCGCTTC
TTTCAGTGGTTCAACGTGTCCAACACGACTGGCCTGCCGTGCCTCATCGCGCTGACGGGCTGCGAGACGGAGCAC
ACGAGCAACGACCAGCTGGTGGCCGAGGCCACTGATATCCTGAGGAGCATCTTTGGGGACGATGTGCCCTACCCC
AAGGAGGCCGTCGTGACGCGCTGGGGGTCGGACCGGTTCGCCAGGGGCAGCTACTCGTCGGCGGCGTCGGGGATG
CTCCCGGACGACTACGACACCATGTCCCGCCCCTTGGGGAACCTGTTCTTTGCCGGCGAGCACACCATCGGCACA
CATCCGGCCACGGTCCACGGCGCCTACCTCTCGGGACTTCGGGCGGCAAACGAGGTGCTCGAGGCCATGATCGGC
CCCATTGAAGTGCCGACGCCTTTCGTCCTGCCAAGGGACTCGCTCCTGTTGCACAAGCGCAAGCAGGCGGCCGAA
GACCCCCGCCAGGCCCGACTGGAGGCGTACGAGGCCGAGATCTGGGACCACGTCCGGTCTCAAATCGGCGAGCGC
CCGGCCCGGCCCAGCAAGGCGGCCGCCAACGCCTACCTGATCTTCAGCAAGCAGAAGCTCGACGAGGCCAGGAGG
AGGTGCGAGGAGAGCCGTAAGGCGGGCAAGGCGCGCAACGGGTCCAGCGAGGTGCGCGTCATGTTATCTAGGATG
TGGAAGGACGCCACGCCCGATGAGCGCCGCCCCTTTGAGCTCCAGGCGGCCGAGCAGAAGGTGACTTATACCGAG
GCGATGCGCGTCTTTAGCGAGCAATCGCAGAAGTGGGATCGCGAGGCTGCCGCCCTCAGAACCGCCTACGAGAGG
GATCACCCCAGCGTGCCGGGACCACACGAGCCGGCGCACGACGAGACGCCGCAGAAGCATCGTCGTGTCAAGCTC
GCCGGCGGTTAG
Transcript >Ophcf2|00442
ATGAGACACGAGAGCTCTGCAGAGCCGGTTGATCAAAGGGGGATCGGCGATTGTTCGACGGCACATTGGCAGATG
GCGGATATGGAGACGACAGTCAGCGGCCTCTTCCAAGGCCTCAATGAAAGCGACGATGCCGAATCGGTGTCATCG
TCGAGGTCTATACACGTTTCTCTCTTAGCAAGCGCTGCGGCGTCGACGGTCCGAGCTCCTTGCCTCGACAGTTCC
TCACCTGAATCGCGGCAAGAGCCTTCAGATGCGTCACGGTCACCCCGAAGCGTTGTCTGGTCAGCGTCAGACAAA
CCCGGAGACATGGATTCGAAAGCATCTCCTACTGTGAAGGCTGGCTCCAATGACCCAGCGCCTCAACCGCAAAGT
GAAGAGCCCACTCTGCCTGCGTCTTGCGACAAGAACGATGCCACCGGCTCGTTTGCTTCATCCCTCTCGGTTCTC
ACGGAGATGTCAGATTTATCGTCTCCGCCTTCGAGTGAATATAGCAAGGCTACTACCCCTGCCGAGGCGGACACG
ACGCGCACACAGCAAAACGAGGACCACCTCAAGCAGGGTGAAATGAGAGACGAGCAACGGCCCCGGCCGGGCGAC
GATCACGGCCAGCAGCCGAGTAAGCCGTCGTCGTATTACCATAACATCGAACGCCTAAGCTTTACCATCCGGCCC
AAGTCGTCCATCCCCGCCGACATGTCATTGGAGCAGTACGCCGGCGAGTGCATCGACGCGGCTGAATGTTCGCGG
CTCAATCCCTACGCACTCCACCCCGAGGAATATATTCTTCTTCGACACCACATATCACACGCCCAAGTCACGACA
TATCTCAACATCAGAAACGGCATCCTCCGTCTGTGGATGCTGCGCCCCTGGATTGGCGTCGCACGGGAAGACGCC
GTCGCCTGTGCTAATACCCGATGGTTCGACGCTGCGAGCGTCTGTTACGATTGGCTGGTCCGTCGCGGCTACATC
AACTTTGGCTGCGTGCAGATTCCGGACGTCGTCAGCGAGAAAGCAGATTCGCCACGAGTGAAGAGAAGGAAGACG
GTCGCCGTCATCGGCGCCGGCATCTCCGGCCTGGCCTGCGCGAGGCAGCTTGAAGGCCTGTTCAAGCAGTACGCC
CAATGGCATCGCGAGAATGGGGATGAGGTCCCCCGGGTGGTGGTGCTGGAGGGCAGGGCTCGTGTAGGGGGCAGA
GTGTACTCTCGCGAGTTCAAGAGCAGGTCTGTTGATCAGCAGCCGACGAGACACACGGCCGAGATGGGAGGCATG
ATCATCACGGGCTTCGAACGCGGAAACCCGATGAACGTGCTGGTACGCGGACAGCTCGGACTGCCCTACCACCCG
CTGACGGCAGACACGACGATATACGACAGCAACGGCAAGCCGGTAGACGCCGTCCGTGATCAGCTGGTCGAGAAG
CTCTACAACGACTGCCTGGACCGGGTGAGCGAGTTCAAGTTCAAGCCTCAGCCGGCCAAACTGATCGAGGGCAAC
CGTCTCCTGCTGGCCGAGGGCCGCGACGGCGTCGCCGACGGCAACAAGACGGTCATGCAGGCTGAGGAAGCGGCC
GCTGCCCTGCCTCACGCAGCTCCCGTTTCGCAGCAGAACGTCCCGGACAAGGTCAACCTGGTACCCGTATCGGCC
GACAAGCTGACGGGCCGCGTTCATACGGAGCCGGGCGTGCCGGCGACGCTGAGGGCTGCCGACAAGGCCAAGCTG
ATGGGCTGGAACCTGCGGTCTGGGGCTTCTGGCGACTTCAACATCGACCTCGGAAAGGCGGCCTCTCTACCGGGC
GCCACGCTGGGGTCCGTCCTGGACGAGGCCATATCACAGTACAGGAACTTGGTTGACCTGAGCGCGCAGGACCAC
CGGCTCATCAACTGGCATGTGGCCAATCTCGAGTACAGCAACGCCAACAGCCTGCGCAACTTGAGCCTCGAGCTG
TGGGACATGGACGCCGGAAACGAGTGGGAGGGCCAGCACACCATGGTGGTCGGGGGCTACCAGGCCGTCGCCCGC
GGCCTGCTGCAGTGTCCGACCAGGCTGGATCTGACGACCAAGTTCCCCGTCAAGAGTATCAAGTATCATGCAGAC
GGCTTCGACGGAACGGCCACGATCGAGTCTGAGAGCGGAGAGACTGTCGAGGCCGACTGCGTCATTTGCACCGTC
CCGCTCGGCGTCCTGAAGCAGAGCAGCATCACCTTCGATCCGCCGCTGCCGCCGTGGAAGACGGGCGTCATCGAC
AGGCTCGGCTTCGGCATACTGAACAAGGTGGTTCTGGTCTACGACGACGTCTTCTGGGACCCCGACAGACACATC
TTTGGCGTGCTCCGGGACGCGCCCAACCGACACAGCACGGCGCAGAAGGACTATGGCGCCAACAGGGGCCGCTTC
TTTCAGTGGTTCAACGTGTCCAACACGACTGGCCTGCCGTGCCTCATCGCGCTGACGGGCTGCGAGACGGAGCAC
ACGAGCAACGACCAGCTGGTGGCCGAGGCCACTGATATCCTGAGGAGCATCTTTGGGGACGATGTGCCCTACCCC
AAGGAGGCCGTCGTGACGCGCTGGGGGTCGGACCGGTTCGCCAGGGGCAGCTACTCGTCGGCGGCGTCGGGGATG
CTCCCGGACGACTACGACACCATGTCCCGCCCCTTGGGGAACCTGTTCTTTGCCGGCGAGCACACCATCGGCACA
CATCCGGCCACGGTCCACGGCGCCTACCTCTCGGGACTTCGGGCGGCAAACGAGGTGCTCGAGGCCATGATCGGC
CCCATTGAAGTGCCGACGCCTTTCGTCCTGCCAAGGGACTCGCTCCTGTTGCACAAGCGCAAGCAGGCGGCCGAA
GACCCCCGCCAGGCCCGACTGGAGGCGTACGAGGCCGAGATCTGGGACCACGTCCGGTCTCAAATCGGCGAGCGC
CCGGCCCGGCCCAGCAAGGCGGCCGCCAACGCCTACCTGATCTTCAGCAAGCAGAAGCTCGACGAGGCCAGGAGG
AGGTGCGAGGAGAGCCGTAAGGCGGGCAAGGCGCGCAACGGGTCCAGCGAGGTGCGCGTCATGTTATCTAGGATG
TGGAAGGACGCCACGCCCGATGAGCGCCGCCCCTTTGAGCTCCAGGCGGCCGAGCAGAAGGTGACTTATACCGAG
GCGATGCGCGTCTTTAGCGAGCAATCGCAGAAGTGGGATCGCGAGGCTGCCGCCCTCAGAACCGCCTACGAGAGG
GATCACCCCAGCGTGCCGGGACCACACGAGCCGGCGCACGACGAGACGCCGCAGAAGCATCGTCGTGTCAAGCTC
GCCGGCGGTTAG
Gene >Ophcf2|00442
ATGAGACACGAGAGCTCTGGTCAGTGGGCGACGGATATACTGGGAAGGCCTCTTGCGTGAAGGCACATAGGTCAA
CAACTCGGTCTGCTGACGCAGGCGAGCAGCAGAGCCGGTTGATCAAAGGGGGTAGTCTCCATGATGCGACTCACC
ATACCGCCGACGAGATTATAACCCAACAGGATCGGCGATTGTTCGACGGCACATTGGCAGATGGCGGATATGGAG
ACGACAGTCAGCGGCCTCTTCCAAGGCCTCAATGAAAGCGACGATGCCGAATCGGTGTCATCGTCGAGGTCTATA
CACGTTTCTCTCTTAGCAAGCGCTGCGGCGTCGACGGTCCGAGCTCCTTGCCTCGACAGTTCCTCACCTGAATCG
CGGCAAGAGCCTTCAGATGCGTCACGGTCACCCCGAAGCGTTGTCTGGTCAGCGTCAGACAAACCCGGAGACATG
GATTCGAAAGCATCTCCTACTGTGAAGGCTGGCTCCAAGTAAGTTCTGAGCTGTGAAGTTGTGTTTTTTCATCGC
TGCATCCCTCATCATTAATGTTATAAAAGTGACCCAGCGCCTCAACCGCAAAGTGAAGAGCCCACTCTGCCTGCG
TCTTGCGACAAGAACGATGCCACCGGCTCGTTTGCTTCATCCCTCTCGGTTCTCACGGAGATGTCAGATTTATCG
TCTCCGCCTTCGAGTGAATATAGCAAGGCTACTACCCCTGCCGAGGCGGACACGACGCGCACACAGCAAAACGAG
GACCACCTCAAGCAGGGTGAAATGAGAGACGAGCAACGGCCCCGGCCGGGCGACGATCACGGCCAGCAGCCGAGT
AAGCCGTCGTCGTATTACCATAACATCGAACGCCTAAGCTTTACCATCCGGCCCAAGTCGTCCATCCCCGCCGAC
ATGTCATTGGAGCAGTACGCCGGCGAGTGCATCGACGCGGCTGAATGTTCGCGGCTCAATCCCTACGCACTCCAC
CCCGAGGAATATATTCTTCTTCGACACCACATATCACACGCCCAAGTCACGACATATCTCAACATCAGAAACGGC
ATCCTCCGTCTGTGGATGCTGCGCCCCTGGATTGGCGTCGCACGGGAAGACGCCGTCGCCTGTGCTAATACCCGA
TGGTTCGACGCTGCGAGCGTCTGTTACGATTGGCTGGTCCGTCGCGGCTACATCAACTTTGGCTGCGTGCAGATT
CCGGACGTCGTCAGCGAGAAAGCAGATTCGCCACGAGTGAAGAGAAGGAAGACGGTCGCCGTCATCGGCGCCGGC
ATCTCCGGCCTGGCCTGCGCGAGGCAGCTTGAAGGCCTGTTCAAGCAGTACGCCCAATGGCATCGCGAGAATGGG
GATGAGGTCCCCCGGGTGGTGGTGCTGGAGGGCAGGGCTCGTGTAGGGGGCAGAGTGTACTCTCGCGAGTTCAAG
AGCAGGTCTGTTGATCAGCAGCCGACGAGACACACGGCCGAGATGGGAGGCATGATCATCACGGGCTTCGAACGC
GGAAACCCGATGAACGTGCTGGTACGCGGACAGCTCGGACTGCCCTACCACCCGCTGACGGCAGACACGACGATA
TACGACAGCAACGGCAAGCCGGTAGACGCCGTCCGTGATCAGCTGGTCGAGAAGCTCTACAACGACTGCCTGGAC
CGGGTGAGCGAGTTCAAGTTCAAGCCTCAGCCGGCCAAACTGATCGAGGGCAACCGTCTCCTGCTGGCCGAGGGC
CGCGACGGCGTCGCCGACGGCAACAAGACGGTCATGCAGGCTGAGGAAGCGGCCGCTGCCCTGCCTCACGCAGCT
CCCGTTTCGCAGCAGAACGTCCCGGACAAGGTCAACCTGGTACCCGTATCGGCCGACAAGCTGACGGGCCGCGTT
CATACGGAGCCGGGCGTGCCGGCGACGCTGAGGGCTGCCGACAAGGCCAAGCTGATGGGCTGGAACCTGCGGTCT
GGGGCTTCTGGCGACTTCAACATCGACCTCGGAAAGGCGGCCTCTCTACCGGGCGCCACGCTGGGGTCCGTCCTG
GACGAGGCCATATCACAGTACAGGAACTTGGTTGACCTGAGCGCGCAGGACCACCGGCTCATCAACTGGCATGTG
GCCAATCTCGAGTACAGCAACGCCAACAGCCTGCGCAACTTGAGCCTCGAGCTGTGGGACATGGACGCCGGAAAC
GAGTGGGAGGGCCAGCACACCATGGTGGTCGGGGGCTACCAGGCCGTCGCCCGCGGCCTGCTGCAGTGTCCGACC
AGGCTGGATCTGACGACCAAGTTCCCCGTCAAGAGTATCAAGTATCATGCAGACGGCTTCGACGGAACGGCCACG
ATCGAGTCTGAGAGCGGAGAGACTGTCGAGGCCGACTGCGTCATTTGCACCGTCCCGCTCGGCGTCCTGAAGCAG
AGCAGCATCACCTTCGATCCGCCGCTGCCGCCGTGGAAGACGGGCGTCATCGACAGGCTCGGCTTCGGCATACTG
AACAAGGTGGTTCTGGTCTACGACGACGTCTTCTGGGACCCCGACAGACACATCTTTGGCGTGCTCCGGGACGCG
CCCAACCGACACAGCACGGCGCAGAAGGACTATGGCGCCAACAGGGGCCGCTTCTTTCAGTGGTTCAACGTGTCC
AACACGACTGGCCTGCCGTGCCTCATCGCGCTGACGGGCTGCGAGACGGAGCACACGAGCAACGACCAGCTGGTG
GCCGAGGCCACTGATATCCTGAGGAGCATCTTTGGGGACGATGTGCCCTACCCCAAGGAGGCCGTCGTGACGCGC
TGGGGGTCGGACCGGTTCGCCAGGGGCAGCTACTCGTCGGCGGCGTCGGGGATGCTCCCGGACGACTACGACACC
ATGTCCCGCCCCTTGGGGAACCTGTTCTTTGCCGGCGAGCACACCATCGGCACACATCCGGCCACGGTCCACGGC
GCCTACCTCTCGGGACTTCGGGCGGCAAACGAGGTGCTCGAGGCCATGATCGGCCCCATTGAAGTGCCGACGCCT
TTCGTCCTGCCAAGGGACTCGCTCCTGTTGCACAAGCGCAAGCAGGCGGCCGAAGACCCCCGCCAGGCCCGACTG
GAGGCGTACGAGGCCGAGATCTGGGACCACGTCCGGTCTCAAATCGGCGAGCGCCCGGCCCGGCCCAGCAAGGCG
GCCGCCAACGCCTACCTGATCTTCAGCAAGCAGAAGCTCGACGAGGCCAGGAGGAGGTGCGAGGAGAGCCGTAAG
GCGGGCAAGGCGCGCAACGGGTCCAGCGAGGTGCGCGTCATGTTATCTAGGATGTGGAAGGACGCCACGCCCGAT
GAGCGCCGCCCCTTTGAGCTCCAGGCGGCCGAGCAGAAGGTGACTTATACCGAGGCGATGCGCGTCTTTAGCGAG
CAATCGCAGAAGTGGGATCGCGAGGCTGCCGCCCTCAGAACCGCCTACGAGAGGGATCACCCCAGCGTGCCGGGA
CCACACGAGCCGGCGCACGACGAGACGCCGCAGAAGCATCGTCGTGTCAAGCTCGCCGGCGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail