Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00435
Gene name
Locationscaffold_01:1779778..1782177
Strand-
Gene length (bp)2399
Transcript length (bp)2025
Coding sequence length (bp)2025
Protein length (aa) 675

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13086 AAA_11 AAA domain 7.1E-57 199 414
PF13087 AAA_12 AAA domain 8.6E-52 431 639
PF13604 AAA_30 AAA domain 1.7E-10 198 431
PF13245 AAA_19 AAA domain 1.4E-07 203 409
PF00580 UvrD-helicase UvrD/REP helicase N-terminal domain 1.3E-05 200 376

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004386 helicase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5103 0.6361 0.0076 0.0598 0.0942 0.0413 0.0582 0.0371 0.0211 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2823
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5330
Ophiocordyceps australis map64 (Brazil) OphauB2|7633
Ophiocordyceps camponoti-floridani Ophcf2|00435 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7038
Ophiocordyceps kimflemingae Ophio5|7656
Ophiocordyceps subramaniannii Hirsu2|4571

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00435
MDVPSFATAQLSLLAQELQAELSETSNAIGSHAPTTLQRAGLAITNLVITSRRTGLAGRTVLTLEPDPATGGVLP
ESHAVRSGDIVLVSGQPAGSARKSDVRELERKGVRGVVVKVQKASLCVAVDEEGGRDEPALAGRVWAVKLADEVT
HRRMSQAMEKLRDMTEPEYSTFIRVLFGIERPSPVSMDVDEPEWFDPTLNGSQKDAIRFALASREIALIHGPPGT
GKTHTLVELILQLVKAGQRVLVCGPSNISVDNLVERLSRHKLPSMLRIGHPARLLPSVVRHSLDALTQTSDAGSI
VRDVRADMDARQAAIGKTRSGRERREIYGQLRELRKEYRERERKCVGGLLAASNVVLATLHGAGGFQLRGQRFDV
VVIDEASQALEAQCWVPLLAAGKAVCAGDHLQLPPTIKSTTTKSTTRVKTSSCVKLETTLFDRLLALHGPDMKRM
LTTQYRMHEAIMRFPSDHLYESKLVAAEAVRTRLLRDLEYGVEDCDDTREPLVFIDTQGGDCPERSDGDDLDERR
GKGAVLGDSKSNEMEAALVRQHVGRLVKAGVRPEDVAVVTPYNGQLALLAPLKDEFPGIELGSVDGFQGREKEAV
VVSLVRSNADGDVGFLGEKRRLNVAMTRPKRSLTVIGDSETASRGSKFMKKWMTFLEENADLRYPDLTTLGDGD*
Coding >Ophcf2|00435
ATGGACGTCCCCTCCTTCGCCACCGCTCAACTCTCCCTCCTCGCCCAAGAACTCCAAGCCGAGCTCTCCGAAACC
AGCAACGCCATCGGCTCGCACGCCCCGACCACGCTTCAACGCGCCGGCCTCGCCATCACCAACCTCGTCATCACC
TCCCGACGCACCGGCCTCGCCGGCCGCACTGTTCTTACTCTCGAGCCGGATCCTGCTACCGGCGGGGTCCTTCCG
GAGTCGCACGCTGTTCGGTCGGGCGACATCGTGCTCGTGTCGGGTCAGCCTGCTGGGAGCGCGAGGAAGAGTGAT
GTCCGGGAGTTGGAGCGGAAGGGGGTGCGTGGTGTTGTCGTCAAGGTTCAGAAGGCTTCGCTCTGTGTGGCTGTT
GATGAGGAGGGGGGCAGGGATGAGCCTGCGCTTGCGGGGAGGGTTTGGGCTGTGAAGCTGGCTGATGAGGTGACG
CATCGACGTATGAGCCAGGCCATGGAGAAGCTGCGAGACATGACTGAGCCGGAGTACTCGACTTTTATACGCGTC
TTGTTTGGCATCGAGAGACCTTCGCCCGTGTCGATGGATGTCGACGAGCCGGAATGGTTTGACCCGACGCTCAAT
GGGTCGCAAAAGGATGCTATACGCTTTGCCCTGGCATCGCGAGAGATCGCCCTCATACACGGTCCGCCAGGGACG
GGCAAAACCCACACGCTGGTCGAGCTGATCCTGCAACTGGTAAAAGCCGGCCAACGCGTCCTCGTCTGCGGCCCT
TCCAACATCTCCGTCGACAACCTCGTCGAGCGGCTGTCGCGTCACAAGCTGCCATCGATGCTGCGCATAGGTCAT
CCAGCGAGGCTGCTCCCCTCGGTCGTGAGGCACTCTCTCGATGCGCTGACGCAGACCTCGGATGCTGGCTCTATC
GTCCGGGACGTTCGTGCCGACATGGATGCTAGGCAGGCTGCCATCGGCAAGACTCGCAGCGGGAGGGAGAGGCGC
GAGATTTACGGGCAGCTTAGGGAGTTGAGGAAGGAGTATCGTGAGAGGGAGAGGAAGTGTGTCGGCGGTCTCCTT
GCCGCCAGCAACGTCGTTCTCGCCACCTTGCATGGTGCTGGGGGGTTTCAGCTGAGGGGGCAGCGCTTCGACGTG
GTGGTTATTGACGAGGCGAGTCAGGCGCTCGAGGCGCAGTGTTGGGTTCCGCTGTTGGCGGCCGGGAAGGCTGTC
TGCGCGGGTGACCATCTACAGTTACCGCCGACCATCAAGTCGACGACGACGAAGAGCACGACGAGGGTCAAGACG
AGCTCATGTGTCAAGCTGGAGACGACCTTGTTCGATCGGCTTCTGGCGCTGCACGGTCCGGACATGAAGCGCATG
CTCACGACGCAGTATCGCATGCACGAGGCCATCATGCGCTTCCCCTCGGACCATCTCTACGAGTCCAAGCTGGTG
GCTGCCGAGGCTGTGAGGACGAGGCTGCTCAGGGATCTCGAGTACGGCGTGGAGGACTGCGACGATACGCGCGAG
CCGCTCGTCTTTATTGATACGCAGGGCGGTGACTGTCCCGAGAGGAGCGATGGCGATGATTTGGACGAGCGGAGG
GGGAAGGGGGCCGTGCTGGGCGACAGCAAGAGTAATGAGATGGAGGCTGCGTTGGTGAGGCAGCATGTTGGAAGG
CTGGTCAAGGCGGGAGTGCGGCCTGAGGATGTGGCTGTCGTTACGCCTTACAACGGACAGTTGGCTTTGTTGGCG
CCTCTCAAGGATGAGTTTCCGGGCATTGAGCTGGGGAGCGTGGATGGCTTTCAGGGGCGGGAGAAGGAGGCTGTT
GTTGTCAGCTTGGTGAGGAGCAATGCTGATGGCGACGTTGGCTTCTTGGGTGAGAAGAGGAGGTTGAATGTTGCC
ATGACGCGCCCGAAGCGCTCACTGACCGTCATTGGTGATTCCGAGACGGCGTCGAGGGGCAGCAAGTTCATGAAG
AAGTGGATGACGTTTTTGGAAGAGAATGCCGACCTGCGGTATCCGGATCTAACGACGCTGGGCGACGGCGACTGA
Transcript >Ophcf2|00435
ATGGACGTCCCCTCCTTCGCCACCGCTCAACTCTCCCTCCTCGCCCAAGAACTCCAAGCCGAGCTCTCCGAAACC
AGCAACGCCATCGGCTCGCACGCCCCGACCACGCTTCAACGCGCCGGCCTCGCCATCACCAACCTCGTCATCACC
TCCCGACGCACCGGCCTCGCCGGCCGCACTGTTCTTACTCTCGAGCCGGATCCTGCTACCGGCGGGGTCCTTCCG
GAGTCGCACGCTGTTCGGTCGGGCGACATCGTGCTCGTGTCGGGTCAGCCTGCTGGGAGCGCGAGGAAGAGTGAT
GTCCGGGAGTTGGAGCGGAAGGGGGTGCGTGGTGTTGTCGTCAAGGTTCAGAAGGCTTCGCTCTGTGTGGCTGTT
GATGAGGAGGGGGGCAGGGATGAGCCTGCGCTTGCGGGGAGGGTTTGGGCTGTGAAGCTGGCTGATGAGGTGACG
CATCGACGTATGAGCCAGGCCATGGAGAAGCTGCGAGACATGACTGAGCCGGAGTACTCGACTTTTATACGCGTC
TTGTTTGGCATCGAGAGACCTTCGCCCGTGTCGATGGATGTCGACGAGCCGGAATGGTTTGACCCGACGCTCAAT
GGGTCGCAAAAGGATGCTATACGCTTTGCCCTGGCATCGCGAGAGATCGCCCTCATACACGGTCCGCCAGGGACG
GGCAAAACCCACACGCTGGTCGAGCTGATCCTGCAACTGGTAAAAGCCGGCCAACGCGTCCTCGTCTGCGGCCCT
TCCAACATCTCCGTCGACAACCTCGTCGAGCGGCTGTCGCGTCACAAGCTGCCATCGATGCTGCGCATAGGTCAT
CCAGCGAGGCTGCTCCCCTCGGTCGTGAGGCACTCTCTCGATGCGCTGACGCAGACCTCGGATGCTGGCTCTATC
GTCCGGGACGTTCGTGCCGACATGGATGCTAGGCAGGCTGCCATCGGCAAGACTCGCAGCGGGAGGGAGAGGCGC
GAGATTTACGGGCAGCTTAGGGAGTTGAGGAAGGAGTATCGTGAGAGGGAGAGGAAGTGTGTCGGCGGTCTCCTT
GCCGCCAGCAACGTCGTTCTCGCCACCTTGCATGGTGCTGGGGGGTTTCAGCTGAGGGGGCAGCGCTTCGACGTG
GTGGTTATTGACGAGGCGAGTCAGGCGCTCGAGGCGCAGTGTTGGGTTCCGCTGTTGGCGGCCGGGAAGGCTGTC
TGCGCGGGTGACCATCTACAGTTACCGCCGACCATCAAGTCGACGACGACGAAGAGCACGACGAGGGTCAAGACG
AGCTCATGTGTCAAGCTGGAGACGACCTTGTTCGATCGGCTTCTGGCGCTGCACGGTCCGGACATGAAGCGCATG
CTCACGACGCAGTATCGCATGCACGAGGCCATCATGCGCTTCCCCTCGGACCATCTCTACGAGTCCAAGCTGGTG
GCTGCCGAGGCTGTGAGGACGAGGCTGCTCAGGGATCTCGAGTACGGCGTGGAGGACTGCGACGATACGCGCGAG
CCGCTCGTCTTTATTGATACGCAGGGCGGTGACTGTCCCGAGAGGAGCGATGGCGATGATTTGGACGAGCGGAGG
GGGAAGGGGGCCGTGCTGGGCGACAGCAAGAGTAATGAGATGGAGGCTGCGTTGGTGAGGCAGCATGTTGGAAGG
CTGGTCAAGGCGGGAGTGCGGCCTGAGGATGTGGCTGTCGTTACGCCTTACAACGGACAGTTGGCTTTGTTGGCG
CCTCTCAAGGATGAGTTTCCGGGCATTGAGCTGGGGAGCGTGGATGGCTTTCAGGGGCGGGAGAAGGAGGCTGTT
GTTGTCAGCTTGGTGAGGAGCAATGCTGATGGCGACGTTGGCTTCTTGGGTGAGAAGAGGAGGTTGAATGTTGCC
ATGACGCGCCCGAAGCGCTCACTGACCGTCATTGGTGATTCCGAGACGGCGTCGAGGGGCAGCAAGTTCATGAAG
AAGTGGATGACGTTTTTGGAAGAGAATGCCGACCTGCGGTATCCGGATCTAACGACGCTGGGCGACGGCGACTGA
Gene >Ophcf2|00435
ATGGACGTCCCCTCCTTCGCCACCGCTCAACTCTCCCTCCTCGCCCAAGAACTCCAAGCCGAGCTCTCCGAAACC
AGCAACGCCATCGGCTCGCACGCCCCGACCACGCTTCAACGCGCCGGCCTCGCCATCACCAACCTCGTCATCACC
TCCCGACGCACCGGCCTCGCCGGCCGCACTGTTCTTACTCTCGAGCCGGATCCTGCTACCGGCGGGGTCCTTCCG
GAGTCGCACGCTGTTCGGTCGGGCGACATCGTGCTCGTGTCGGGTCAGCCTGCTGGGAGCGCGAGGAAGAGTGAT
GTCCGGGAGTTGGAGCGGAAGGGGGTGCGTGGTGTTGTCGTCAAGGTTCAGAAGGCTTCGCTCTGTGTGGCTGTT
GATGAGGAGGGGGGCAGGGATGAGCCTGCGCTTGCGGGGAGGGTTTGGGCTGTGAAGCTGGCTGATGAGGTGACG
CATCGACGGTGGGTATATCTTCCCTGTTGGGGTTTCCCAGTGAGGGTTATTGTTGTTGTTGTTGTTGTTGTTGTT
GTTGTTGTTGTTGTTGTTGCTGATGGTGGTGATGATGGTGGTGGTAGTATGAGCCAGGCCATGGAGAAGCTGCGA
GACATGACTGAGCCGGAGTACTCGACTTTTATACGCGTCTTGTTTGGCATCGAGAGACCTTCGCCCGTGTCGATG
GATGTCGACGAGCCGGAATGGTTTGACCCGACGCTCAATGGGTCGCAAAAGGATGCTATACGCTTTGCCCTGGCA
TCGCGAGAGATCGCCCTCATACACGGTCCGCCAGGGGTGAGTTCTACCGCCAAAGGAGACGTCGTCGACGACCGC
TGACCCTCTCCACCCTCCTGACAGACGGGCAAAACCCACACGCTGGTCGAGCTGATCCTGCAACTGGTAAAAGCC
GGCCAACGCGTCCTCGTCTGCGGCCCTTCCAACATCTCCGTCGACAACCTCGTCGAGCGGCTGTCGCGTCACAAG
CTGCCATCGATGCTGCGCATAGGTCATCCAGCGAGGCTGCTCCCCTCGGTCGTGAGGCACTCTCTCGATGCGCTG
ACGCAGACCTCGGATGCTGGCTCTATCGTCCGGGACGTTCGTGCCGACATGGATGCTAGGCAGGCTGCCATCGGC
AAGACTCGCAGCGGGAGGGAGAGGCGCGAGATTTACGGGCAGCTTAGGGAGTTGAGGAAGGAGTATCGTGAGAGG
GAGAGGAAGTGTGTCGGCGGTCTCCTTGCCGCCAGCAACGTCGTTCTCGCCACCTTGCATGGTGCTGGGGGGTTT
CAGCTGAGGGGGCAGCGCTTCGACGTGGTGGTTATTGACGAGGCGAGTCAGGCGCTCGAGGCGCAGTGTTGGGTT
CCGCTGTTGGCGGCCGGGAAGGCTGTCTGCGCGGGTGACCATCTACAGTTACCGCCGACCATCAAGTCGACGACG
ACGAAGAGCACGACGAGGGTCAAGACGAGCTCATGTGTCAAGCTGGAGACGACCTTGTTCGATCGGCTTCTGGCG
CTGCACGGTCCGGACATGAAGCGCATGCTCACGACGCAGTATCGCATGCACGAGGCCATCATGCGCTTCCCCTCG
GACCATCTCTACGAGTCCAAGCTGGTGGCTGCCGAGGCTGTGAGGACGAGGCTGCTCAGGGATCTCGAGTACGGC
GTGGAGGACTGCGACGATACGCGCGAGCCGCTCGTCTTTATTGATACGCAGGGCGGTGACTGTCCCGAGAGGAGC
GATGGCGATGATTTGGACGAGCGGAGGGGGAAGGGGGCCGTGCTGGGCGACAGCAAGAGTAATGAGATGGAGGCT
GCGTTGGTGAGGCAGCATGTTGGAAGGCTGGTCAAGGCGGGAGTGCGGCCTGAGGATGTGGCTGTCGTTACGCCT
TACAACGGACAGGTATGGCGTTTTCTTTTCTGTTTGACGTGGGTTTTGGGGAAGACTCTTTGCTGATGGGCTTTA
GTTGGCTTTGTTGGCGCCTCTCAAGGATGAGTTTCCGGGCATTGAGCTGGGGAGCGTGGATGGCTTTCAGGGGCG
GGAGAAGGAGGCTGTTGTTGTCAGCTTGGTGAGGAGCAATGCTGATGGCGACGTTGGCTTCTTGGGTGAGAAGAG
GAGGTTGAATGGTGAGAGGAGCCTCTTTCTACGTCCCAATTATCATGAATTGGGGGGGTGTTTCAACTGACGTTG
TGAAATCAGTTGCCATGACGCGCCCGAAGCGCTCACTGACCGTCATTGGTGATTCCGAGACGGCGTCGAGGTGAG
AGCAGAGAGGGTGAGGTACGTACGTACACATTGGACATGGCTGACGATTGGCCAGGGGCAGCAAGTTCATGAAGA
AGTGGATGACGTTTTTGGAAGAGAATGCCGACCTGCGGTATCCGGATCTAACGACGCTGGGCGACGGCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail