Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00425
Gene name
Locationscaffold_01:1755542..1757233
Strand-
Gene length (bp)1691
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03208 PRA1 PRA1 family protein 4.0E-35 33 167

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 89 107 18
3 128 150 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00425
MSRIQIPLDALTSRLNLHDRLQGFRPGPLTGRFSNLRPVSEFLDFKRVSKPANFAEMQSRVNYNLSHFSSNYAVV
FSMLSIYALLTNWVLLFDIVLVVVGMFLIGRLEGRDLEIGNFRASSSQLYTGLLIVAVPLGLIASPFSTLLWLIG
ASGVAILGHASFMDKPIDEAFSGEAGPWDGVSRVEELDTDGEDGLDAQRGGRFVSDSLRFTGIDLGDRTGNTVSR
RRHGDSSDDDDDDDDDDDDGSSTCSDVDEDGEGNEEEKDDEEEALVQSALQRIDRARARGKADVRLNKDELAALE
RRRRRMHEEEERRRRKAREERVAVPLTHLEPISRDRGNINRQDPTPRHVSAGSTMAEGSEQRPMYPPMGYFPPPI
SSYPRQRSGLSTSTSSRHVSDSATRLRSSRHSPPDDDGDDDDFLPRSRAQAVDPFVYQTAGPRVLPSGGRRYVSG
PAEMIRGGRRGQQSYGDETSSEDDGSSSSEVGSRSRARPARGRTGEAAVEASPEPRRKKGSPASSSKKKASSSGG
KRRKK*
Coding >Ophcf2|00425
ATGTCGCGCATACAGATCCCCCTCGACGCCCTCACCTCGCGTCTCAACCTCCATGACCGGCTGCAGGGCTTCCGT
CCCGGGCCGCTGACGGGCCGCTTCTCCAACCTACGGCCCGTCTCCGAGTTTCTCGACTTCAAGCGCGTGTCCAAG
CCGGCCAACTTTGCAGAGATGCAGTCGCGTGTCAACTACAACCTCAGCCACTTCTCCAGCAACTACGCCGTCGTC
TTCTCCATGCTCAGCATCTATGCGCTGCTGACCAACTGGGTGCTACTCTTCGACATTGTTCTCGTCGTTGTCGGC
ATGTTTCTCATCGGCCGTCTCGAGGGCCGCGATCTGGAGATTGGCAACTTTCGCGCTTCGTCGTCCCAGCTCTAC
ACTGGCCTTCTCATCGTGGCCGTGCCGCTGGGCCTGATTGCCTCGCCCTTTTCCACGCTGCTCTGGCTCATTGGC
GCTTCTGGTGTGGCCATTCTTGGTCACGCCTCGTTCATGGATAAGCCCATCGATGAGGCTTTTTCCGGGGAGGCG
GGGCCTTGGGACGGCGTTTCCAGGGTCGAGGAGCTGGACACGGATGGGGAGGACGGCTTGGACGCGCAGAGGGGC
GGCCGCTTCGTTAGCGATTCTCTTCGATTTACGGGTATAGACTTGGGTGACCGGACCGGCAACACGGTCAGTCGC
AGGCGTCATGGTGATTCCAGCGACGACGACGACGACGACGACGACGACGACGACGATGGCTCTTCGACTTGCAGT
GACGTCGACGAGGACGGGGAGGGGAACGAGGAGGAGAAGGATGACGAGGAGGAGGCTTTGGTGCAGTCGGCTCTG
CAACGCATCGACCGGGCCCGCGCCAGGGGTAAGGCCGATGTTCGGCTGAACAAGGACGAGCTGGCGGCGCTCGAG
CGGAGGCGAAGGCGAATGCACGAGGAGGAAGAGAGGAGGAGAAGGAAGGCGAGGGAAGAGCGTGTGGCAGTTCCG
CTGACGCACCTCGAGCCCATATCCCGCGATCGAGGGAATATCAATCGGCAGGACCCGACTCCGCGACACGTCTCG
GCCGGCAGCACCATGGCCGAGGGCTCGGAGCAACGGCCCATGTATCCTCCAATGGGATACTTTCCGCCGCCCATC
TCGTCTTACCCGAGGCAACGGTCTGGCTTGTCGACGTCGACTTCGAGCCGACACGTATCCGATTCGGCGACGCGT
CTGCGGTCTTCGAGGCACTCACCTCCCGACGACGACGGCGACGACGACGATTTCCTCCCGCGAAGTCGCGCTCAA
GCAGTCGACCCGTTCGTATACCAGACGGCGGGTCCCCGGGTATTGCCGAGCGGTGGTCGACGGTACGTGTCGGGC
CCGGCCGAGATGATCCGTGGCGGACGCCGGGGACAGCAAAGCTACGGCGACGAGACGAGCTCGGAAGACGACGGT
TCGAGCAGCAGCGAGGTCGGCTCGCGATCCAGGGCACGGCCGGCCAGGGGACGGACCGGTGAGGCAGCCGTCGAG
GCGTCGCCCGAACCGAGAAGGAAGAAGGGATCGCCGGCCTCGTCGAGTAAGAAGAAGGCTTCGTCGTCGGGGGGG
AAGCGGAGGAAGAAGTAA
Transcript >Ophcf2|00425
ATGTCGCGCATACAGATCCCCCTCGACGCCCTCACCTCGCGTCTCAACCTCCATGACCGGCTGCAGGGCTTCCGT
CCCGGGCCGCTGACGGGCCGCTTCTCCAACCTACGGCCCGTCTCCGAGTTTCTCGACTTCAAGCGCGTGTCCAAG
CCGGCCAACTTTGCAGAGATGCAGTCGCGTGTCAACTACAACCTCAGCCACTTCTCCAGCAACTACGCCGTCGTC
TTCTCCATGCTCAGCATCTATGCGCTGCTGACCAACTGGGTGCTACTCTTCGACATTGTTCTCGTCGTTGTCGGC
ATGTTTCTCATCGGCCGTCTCGAGGGCCGCGATCTGGAGATTGGCAACTTTCGCGCTTCGTCGTCCCAGCTCTAC
ACTGGCCTTCTCATCGTGGCCGTGCCGCTGGGCCTGATTGCCTCGCCCTTTTCCACGCTGCTCTGGCTCATTGGC
GCTTCTGGTGTGGCCATTCTTGGTCACGCCTCGTTCATGGATAAGCCCATCGATGAGGCTTTTTCCGGGGAGGCG
GGGCCTTGGGACGGCGTTTCCAGGGTCGAGGAGCTGGACACGGATGGGGAGGACGGCTTGGACGCGCAGAGGGGC
GGCCGCTTCGTTAGCGATTCTCTTCGATTTACGGGTATAGACTTGGGTGACCGGACCGGCAACACGGTCAGTCGC
AGGCGTCATGGTGATTCCAGCGACGACGACGACGACGACGACGACGACGACGACGATGGCTCTTCGACTTGCAGT
GACGTCGACGAGGACGGGGAGGGGAACGAGGAGGAGAAGGATGACGAGGAGGAGGCTTTGGTGCAGTCGGCTCTG
CAACGCATCGACCGGGCCCGCGCCAGGGGTAAGGCCGATGTTCGGCTGAACAAGGACGAGCTGGCGGCGCTCGAG
CGGAGGCGAAGGCGAATGCACGAGGAGGAAGAGAGGAGGAGAAGGAAGGCGAGGGAAGAGCGTGTGGCAGTTCCG
CTGACGCACCTCGAGCCCATATCCCGCGATCGAGGGAATATCAATCGGCAGGACCCGACTCCGCGACACGTCTCG
GCCGGCAGCACCATGGCCGAGGGCTCGGAGCAACGGCCCATGTATCCTCCAATGGGATACTTTCCGCCGCCCATC
TCGTCTTACCCGAGGCAACGGTCTGGCTTGTCGACGTCGACTTCGAGCCGACACGTATCCGATTCGGCGACGCGT
CTGCGGTCTTCGAGGCACTCACCTCCCGACGACGACGGCGACGACGACGATTTCCTCCCGCGAAGTCGCGCTCAA
GCAGTCGACCCGTTCGTATACCAGACGGCGGGTCCCCGGGTATTGCCGAGCGGTGGTCGACGGTACGTGTCGGGC
CCGGCCGAGATGATCCGTGGCGGACGCCGGGGACAGCAAAGCTACGGCGACGAGACGAGCTCGGAAGACGACGGT
TCGAGCAGCAGCGAGGTCGGCTCGCGATCCAGGGCACGGCCGGCCAGGGGACGGACCGGTGAGGCAGCCGTCGAG
GCGTCGCCCGAACCGAGAAGGAAGAAGGGATCGCCGGCCTCGTCGAGTAAGAAGAAGGCTTCGTCGTCGGGGGGG
AAGCGGAGGAAGAAGTAA
Gene >Ophcf2|00425
ATGTCGCGCATACAGATCCCCCTCGACGCCCTCACCTCGCGTCTCAACCTCCATGACCGGCTGCAGGGCTTCCGT
CCCGGGCCGCTGACGGGCCGCTTCTCCAACCTACGGCCCGTCTCCGAGTTTCTCGACTTCAAGCGCGTGTCCAAG
CCGGCCAACTTTGCAGAGATGCAGTCGCGTGTCAACTACAACCTCAGCCACTTCTCCAGCAACTACGCCGTCGTC
TTCTCCATGCTCAGCATCTATGCGCTGCTGACCAACTGGGTGCTACTCTTCGACATTGTTCTCGTCGTTGTCGGC
ATGTTTCTCATCGGCCGTCTCGAGGGCCGCGATCTGGAGATTGGCAACTTTCGCGCTTCGTCGTCCCAGCTCTAC
ACTGGCCTTCTCATCGTGGCCGTGCCGCTGGGCCTGATTGCCTCGCCCTTTTCCACGCTGCTCTGGCTCATTGGC
GCTTCTGGTGTGGCCATTCTTGGTCACGCCTCGTTCATGGATAAGCCCATCGATGAGGCTTTTTCCGGGGAGGCG
GTCTAGGTGGTCGGCCGCGGGCTCCCAAATTTACGCCCCCTTGGGGAAGACCATCGAGGCGCGGGCGGAGGAGGA
CCGAGGGAGATTCCGCGCCTCAGGGGCCTTGGGACGGCGTTTCCAGGGTCGAGGAGCTGGACACGGATGGGGAGG
ACGGCTTGGACGCGCAGAGGGGCGGCCGCTTCGTTAGCGATTCTCTTCGATTTACGGGTATAGACTTGGGTGACC
GGACCGGCAACACGGTCAGTCGCAGGCGTCATGGTGATTCCAGCGACGACGACGACGACGACGACGACGACGACG
ACGATGGCTCTTCGACTTGCAGTGACGTCGACGAGGACGGGGAGGGGAACGAGGAGGAGAAGGATGACGAGGAGG
AGGCTTTGGTGCAGTCGGCTCTGCAACGCATCGACCGGGCCCGCGCCAGGGGTAAGGCCGATGTTCGGCTGAACA
AGGACGAGCTGGCGGCGCTCGAGCGGAGGCGAAGGCGAATGCACGAGGAGGAAGAGAGGAGGAGAAGGAAGGCGA
GGGAAGAGCGTGTGGCAGTTCCGCTGACGCACCTCGAGCCCATATCCCGCGATCGAGGGAATATCAATCGGCAGG
ACCCGACTCCGCGACACGTCTCGGCCGGCAGCACCATGGCCGAGGGCTCGGAGCAACGGCCCATGTATCCTCCAA
TGGGATACTTTCCGCCGCCCATCTCGTCTTACCCGAGGCAACGGTCTGGCTTGTCGACGTCGACTTCGAGCCGAC
ACGTATCCGATTCGGCGACGCGTCTGCGGTCTTCGAGGCACTCACCTCCCGACGACGACGGCGACGACGACGATT
TCCTCCCGCGAAGTCGCGCTCAAGCAGTCGACCCGTTCGTATACCAGACGGCGGGTCCCCGGGTATTGCCGAGCG
GTGGTCGACGGTACGTGTCGGGCCCGGCCGAGATGATCCGTGGCGGACGCCGGGGACAGCAAAGCTACGGCGACG
AGACGAGCTCGGAAGACGACGGTTCGAGCAGCAGCGAGGTCGGCTCGCGATCCAGGGCACGGCCGGCCAGGGGAC
GGACCGGTGAGGCAGCCGTCGAGGCGTCGCCCGAACCGAGAAGGAAGAAGGGATCGCCGGCCTCGTCGAGTAAGA
AGAAGGCTTCGTCGTCGGGGGGGAAGCGGAGGAAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail