Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00423
Gene name
Locationscaffold_01:1752823..1754015
Strand+
Gene length (bp)1192
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03452 Anp1 Anp1 2.0E-107 77 341

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 38.52 19.85 57.19
Alive In ants, during behavior modification 54.22 29.41 79.02
Dead In ants, recently dead 54.48 30.04 78.93

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.101575 no
Alive Dead 0.984346 no
Dead Fungus 0.090333 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00423
MARPLGSVRLKKANPSTLALGLCLCIFILYFLVSPSTRSRPQAPQRPAPAEHHLSPPTQPYKKSNPRDKGPARPP
PVTRYNLNHVTVTAKPIENRERILILTPMSRFYDEYWSNLLRLTYPHDLITLGFILPKTKEGNAATAALQQHIEQ
TQKRGPVADRFNSIIILRQDFESAIISQDEGERHKMANQKARRSVMAKARNSLLFTTLGPATSWVLWLDADIVET
PPTLIQDMAKHDKPLIVANCFQRFYNKDTNKMDERPYDYNSWQDSEIAANLAAKMGPDDILLEGYAEMATFRTLM
AHIGTPDGDKDVTVPLDGVGGTALLVKADVHRDGAMFPPFPFYHLIETEGFAKMAKRLGWQSWGLPNLRVYHYNE
*
Coding >Ophcf2|00423
ATGGCTCGACCCTTGGGGTCGGTCCGCCTCAAGAAGGCGAACCCGTCCACGCTTGCCCTCGGCCTCTGTCTCTGC
ATCTTCATCCTCTACTTCCTCGTCTCGCCCTCGACCCGATCCCGTCCTCAAGCTCCTCAACGTCCCGCCCCTGCA
GAGCATCATCTCTCGCCTCCGACGCAGCCCTACAAGAAGTCGAACCCGCGCGACAAGGGCCCCGCTCGCCCTCCG
CCGGTGACGCGCTACAACCTCAACCATGTCACGGTGACGGCCAAGCCCATTGAGAACCGCGAGCGCATACTGATC
CTCACCCCAATGTCACGCTTCTACGACGAATACTGGTCCAATCTGCTGCGCCTCACCTACCCTCACGACCTCATC
ACTCTCGGCTTTATCCTCCCCAAGACAAAAGAGGGCAACGCCGCGACGGCAGCCCTACAGCAGCACATCGAGCAG
ACGCAGAAACGCGGTCCCGTGGCCGATCGCTTCAACAGCATCATCATCCTCCGTCAAGACTTTGAATCCGCCATC
ATCTCTCAAGACGAGGGCGAGCGTCACAAAATGGCCAACCAAAAGGCCCGTCGCTCGGTCATGGCCAAGGCCCGC
AACTCGCTCCTCTTCACCACGCTCGGCCCCGCCACCTCGTGGGTCCTCTGGCTCGACGCCGACATCGTTGAGACG
CCCCCGACGCTCATCCAGGACATGGCCAAGCACGACAAGCCCCTCATCGTGGCAAACTGCTTCCAGCGCTTCTAC
AACAAGGACACCAACAAGATGGACGAGCGGCCCTACGACTACAACAGCTGGCAGGACAGCGAGATCGCCGCCAAC
CTGGCCGCCAAGATGGGCCCCGACGACATCCTGCTCGAGGGCTACGCCGAGATGGCCACCTTTCGCACCCTCATG
GCCCACATCGGCACCCCCGACGGCGACAAGGACGTGACGGTGCCCCTCGACGGCGTCGGCGGAACCGCCCTCCTC
GTCAAGGCCGACGTCCACCGCGACGGCGCCATGTTCCCACCCTTTCCCTTCTATCACCTCATCGAGACCGAAGGC
TTCGCCAAGATGGCCAAGCGCCTGGGCTGGCAATCCTGGGGCCTACCCAACCTCCGGGTGTACCACTACAACGAG
TAA
Transcript >Ophcf2|00423
ATGGCTCGACCCTTGGGGTCGGTCCGCCTCAAGAAGGCGAACCCGTCCACGCTTGCCCTCGGCCTCTGTCTCTGC
ATCTTCATCCTCTACTTCCTCGTCTCGCCCTCGACCCGATCCCGTCCTCAAGCTCCTCAACGTCCCGCCCCTGCA
GAGCATCATCTCTCGCCTCCGACGCAGCCCTACAAGAAGTCGAACCCGCGCGACAAGGGCCCCGCTCGCCCTCCG
CCGGTGACGCGCTACAACCTCAACCATGTCACGGTGACGGCCAAGCCCATTGAGAACCGCGAGCGCATACTGATC
CTCACCCCAATGTCACGCTTCTACGACGAATACTGGTCCAATCTGCTGCGCCTCACCTACCCTCACGACCTCATC
ACTCTCGGCTTTATCCTCCCCAAGACAAAAGAGGGCAACGCCGCGACGGCAGCCCTACAGCAGCACATCGAGCAG
ACGCAGAAACGCGGTCCCGTGGCCGATCGCTTCAACAGCATCATCATCCTCCGTCAAGACTTTGAATCCGCCATC
ATCTCTCAAGACGAGGGCGAGCGTCACAAAATGGCCAACCAAAAGGCCCGTCGCTCGGTCATGGCCAAGGCCCGC
AACTCGCTCCTCTTCACCACGCTCGGCCCCGCCACCTCGTGGGTCCTCTGGCTCGACGCCGACATCGTTGAGACG
CCCCCGACGCTCATCCAGGACATGGCCAAGCACGACAAGCCCCTCATCGTGGCAAACTGCTTCCAGCGCTTCTAC
AACAAGGACACCAACAAGATGGACGAGCGGCCCTACGACTACAACAGCTGGCAGGACAGCGAGATCGCCGCCAAC
CTGGCCGCCAAGATGGGCCCCGACGACATCCTGCTCGAGGGCTACGCCGAGATGGCCACCTTTCGCACCCTCATG
GCCCACATCGGCACCCCCGACGGCGACAAGGACGTGACGGTGCCCCTCGACGGCGTCGGCGGAACCGCCCTCCTC
GTCAAGGCCGACGTCCACCGCGACGGCGCCATGTTCCCACCCTTTCCCTTCTATCACCTCATCGAGACCGAAGGC
TTCGCCAAGATGGCCAAGCGCCTGGGCTGGCAATCCTGGGGCCTACCCAACCTCCGGGTGTACCACTACAACGAG
TAA
Gene >Ophcf2|00423
ATGGCTCGACCCTTGGGGTCGGTCCGCCTCAAGAAGGCGAACCCGTCCACGCTTGCCCTCGGCCTCTGTCTCTGC
ATCTTCATCCTCTACTTCCTCGTCTCGCCCTCGACCCGATCCCGTCCTCAAGCTCCTCAACGTCCCGCCCCTGCA
GAGCATCATCTCTCGCCTCCGACGCAGCCCTACAAGAAGTCGAACCCGCGCGACAAGGGCCCCGCTCGCCCTCCG
CCGGTGACGCGCTACAACCTCAACCATGTCACGGTGACGGCCAAGCCCATTGAGAACCGCGAGCGCATACTGATC
CTCACCCCAATGTCACGCTTCTACGACGAATACTGGTCCAATCTGCTGCGCCTCACCTACCCTCACGACCTCATC
ACTCTCGGCTTTATCCTCCCCAAGACAAAAGAGGGCAACGCCGCGACGGCAGCCCTACAGCAGCACATCGAGCAG
ACGCAGAAACGCGGTCCCGTGGCCGATCGCTTCAACAGCATCATCATCCTCCGTCAAGACTTTGAATCCGCCATC
ATCTCTCAAGACGAGGGCGAGCGTCACAAAATGGCCAACCAAAAGGCCCGTCGCTCGGTCATGGCCAAGGCCCGC
AACTCGCTCCTCTTCACCACGCTCGGCCCCGCCACCTCGTGGGTCCTCTGGCTCGACGCCGACATCGTTGAGACG
CCCCCGACGCTCATCCAGGACATGGCCAAGCACGACAAGCCCCTCATCGTGGCAAACTGCTTCCAGCGCTTCTAC
AACAAGGACACCAACAAGATGGACGAGCGGCCCTACGACTACAACAGCTGGCAGGACAGCGAGATCGCCGCCAAC
CTGGCCGCCAAGATGGGCCCCGACGACATCCTGCTCGAGGGCTACGCCGAGATGGCCACCTTTCGCACCCTCATG
GCCCACATCGGCACCCCCGACGGCGACAAGGACGTGACGGTGCCCCTCGACGGCGTCGGCGGAACCGCCCTCCTC
GTCAAGGCCGACGTCCACCGCGACGGCGCCATGTTCCCACCCTTTCCCTTCTATCACCTCATCGAGACCGAAGGC
TTCGCCAAGATGGCCAAGCGCCTGGGCTGGCAATCCTGGGGCCTACCCAACCTCCGGGTAAGCCGCTCTCCTCTT
GAAGCGACGAGACCGACGCTGAGCTGACGGCGACCTGATTCGCCAGGTGTACCACTACAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail