Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00416
Gene name
Locationscaffold_01:1739418..1740076
Strand+
Gene length (bp)658
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18126 Mitoc_mL59 Mitochondrial ribosomal protein mL59 5.0E-35 21 150

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1915 0.1967 0.0505 0.0301 0.9532 0.018 0.028 0.0145 0.0099 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5779
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5254
Ophiocordyceps australis map64 (Brazil) OphauB2|7651
Ophiocordyceps camponoti-floridani Ophcf2|00416 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7270
Ophiocordyceps kimflemingae Ophio5|6337
Ophiocordyceps subramaniannii Hirsu2|9635

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00416
MPSAASSASHLIQLAKTLPAPLQRFLARWPPASIAGPGAKPTPWQEERPNPFQCIRDAVTGKRKDPVYSQRRQAK
IVKMARQHGVHSLLPQSSKDIELKLQRRVEFGLRVKGTGVGQRVKGHSHEREMVHRMKERRKAMLALPALIKKYK
RIGKFHWKKWPKP*
Coding >Ophcf2|00416
ATGCCATCAGCCGCCTCCTCAGCTTCGCACCTCATCCAGCTCGCCAAGACCCTCCCGGCGCCTCTCCAACGCTTC
CTCGCCCGCTGGCCGCCCGCCTCCATCGCGGGCCCGGGCGCCAAGCCGACTCCCTGGCAGGAGGAGCGTCCGAAT
CCGTTCCAGTGCATCAGGGATGCCGTCACCGGGAAGCGCAAAGACCCTGTCTACTCCCAGCGGCGACAAGCCAAG
ATAGTCAAGATGGCGCGCCAGCATGGCGTGCACTCGCTGCTTCCGCAATCCAGCAAGGATATCGAGCTCAAGCTT
CAGCGTCGCGTCGAGTTTGGCCTAAGAGTTAAGGGCACCGGTGTGGGACAGCGGGTAAAGGGTCACAGCCACGAG
AGAGAAATGGTTCACAGGATGAAAGAGAGGAGAAAGGCCATGTTGGCTTTGCCCGCGCTTATCAAGAAATACAAG
AGGATTGGCAAGTTCCATTGGAAGAAGTGGCCCAAGCCTTGA
Transcript >Ophcf2|00416
ATGCCATCAGCCGCCTCCTCAGCTTCGCACCTCATCCAGCTCGCCAAGACCCTCCCGGCGCCTCTCCAACGCTTC
CTCGCCCGCTGGCCGCCCGCCTCCATCGCGGGCCCGGGCGCCAAGCCGACTCCCTGGCAGGAGGAGCGTCCGAAT
CCGTTCCAGTGCATCAGGGATGCCGTCACCGGGAAGCGCAAAGACCCTGTCTACTCCCAGCGGCGACAAGCCAAG
ATAGTCAAGATGGCGCGCCAGCATGGCGTGCACTCGCTGCTTCCGCAATCCAGCAAGGATATCGAGCTCAAGCTT
CAGCGTCGCGTCGAGTTTGGCCTAAGAGTTAAGGGCACCGGTGTGGGACAGCGGGTAAAGGGTCACAGCCACGAG
AGAGAAATGGTTCACAGGATGAAAGAGAGGAGAAAGGCCATGTTGGCTTTGCCCGCGCTTATCAAGAAATACAAG
AGGATTGGCAAGTTCCATTGGAAGAAGTGGCCCAAGCCTTGA
Gene >Ophcf2|00416
ATGCCATCAGCCGCCTCCTCAGCTTCGCACCTCATCCAGCTCGCCAAGACCCTCCCGGCGCCTCTCCAACGCTTC
CTCGCCCGCTGGCCGCCCGCCTCCATCGCGGGCCCGGGCGCCAAGCCGACTCCCTGGCAGGAGGAGCGTCCGAAT
CCGTTCCAGTGCATCAGGGATGCCGTCACCGGGAAGCGCAAAGACCCTGTCTACTCCCAGCGGCGACAAGCCAAG
ATAGTCAAGATGGCGCGCCAGCATGGCGTGCACTCGCTGCTTCCGCAATCCAGCAAGGATATCGAGCTCAAGCTT
CAGCGTCGCGTCGAGTTTGGCCTAAGAGTTAAGGGCACCGGTGTGGGACAGCGGGTAAAGGGTCACAGCCACGAG
AGAGAAATGGTTCACAGGTACGCCTCATCCTGCCTCCCCTCCCTTGTTCTCCTCCTCTCTCTCGTCACACTTTGT
TCCTGGCACATCATCGGCAGCAGCTGACGGAGTGCAAATCACGACAGGATGAAAGAGAGGAGAAAGGCCATGTTG
GCTTTGCCCGCGCTTATCAAGAAATACAAGAGGGTAAGTCGCCCCCTATCTCCCCTCTTCTCTTCGCAATGGACT
GACATACGCTTCAAAACAGATTGGCAAGTTCCATTGGAAGAAGTGGCCCAAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail