Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00411
Gene name
Locationscaffold_01:1721720..1725485
Strand-
Gene length (bp)3765
Transcript length (bp)3435
Coding sequence length (bp)3435
Protein length (aa) 1145

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01074 Glyco_hydro_38N Glycosyl hydrolases family 38 N-terminal domain 2.9E-85 349 611
PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain 4.8E-51 786 994
PF09261 Alpha-mann_mid Alpha mannosidase middle domain 2.1E-27 618 714
PF17677 Glyco_hydro38C2 Glycosyl hydrolases family 38 C-terminal beta sandwich domain 5.1E-11 1080 1141

GO

GO Term Description Terminal node
GO:0004559 alpha-mannosidase activity Yes
GO:0006013 mannose metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0044281 small molecule metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0015923 mannosidase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0019318 hexose metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5764 0.4123 0.27 0.0683 0.1664 0.4018 0.376 0.3698 0.3658 0.0456

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH38 8.1E-84 349 607

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4671
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6076
Ophiocordyceps australis map64 (Brazil) OphauB2|1696
Ophiocordyceps camponoti-floridani Ophcf2|00411 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4241
Ophiocordyceps kimflemingae Ophio5|6823
Ophiocordyceps subramaniannii Hirsu2|9842

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00411
MHCTLCTHPIDPAAADYSLAPPSDSSLSHPYIPPPESSRHRPLPLAFLDRHLRRSINRSDPEFYINMGGGGQAKG
NGSYSVFARKPVGVPKTSILKDRIELFYKSGQYDKVNLLANLFKARYSGKPHVKLYVWSAPDQERPTFKEAVSHD
FKETATGASFGPSWSTHWFRIHLTVPKDALDEELVIFEWDAGNEGLVWAPDGTPLQGLTGGGERIEWNMPKSFRD
GKEHVIYIEMACNGMFGNAPSGKTSIAPPDPNRYYALTKADIAVVNVPARMLHFDMWELGDAARELPDTSAEQNK
ALAVAMKIIDTFQVDDQQSILECRKLAREIVGPDVDSHKVYEVGKDPVVYGIGHCHIDTCWLWPWAETKRKICRS
WLSQCDLMDRYPEAHFACSSAQQFKWLKEYYPSAFARVKTKVSDGQFHPIGGSWVEHDTNMPSGESLVRQFFYGQ
RFFEAEFGSRCRTFWLPDTFGYSSQLPQLCRLAGMERFMTQKLSWNNINTFPHTTFMWVSPDGSQVICHMPPSET
YTSDANFGDLSRSISQHKTLRVDSSSLLVFGKGDGGGGPTWQHFEKLRRCAGISNTVGAIPKLKLGLTVDDFFDR
LAPKAGEFPTWHGELYFELHRGTYTTQANNKFFNRKAEVMLRDIEQLATFASIKSDKYSYPSKEIDDMWEAVLLC
QFHDCLPGSSIEMCYDDSDKLYAELFKKGQALLKDLYGHLGASEEQPIGSLGGSVALNTLPWHREEVVEVSDTEV
GIASGDGQLLSLRTLEVAADKPAVRVTEEDKDAFVLENDHLRVVVQGGCITSLYDCVNKREVVEKGGQANKFVMF
DDIPLFWEAWDVEVYHLETERQLTYGKTRIHESKPHKATLVTDIKVSDKSSLKAYISLSAAVKGRTSQVDCSAEV
DWHEDSKFLKVEFPVDVVNTQASYESAYTITKRPTHYNTSWDMAKFEVCCHRFADLSESNYGVSILNDSKYGFAT
VGKMMRLSLLRAPKAPDAHADMGHHSMRWAIFPHGGCLSSETVRAAYAFNNPLKLLSASGTLLWSEAPITLTNVE
DSASLVLDCIKRGHDDEDVSRCQGLPVAKGRSIVLRVYESMGGRSRGTIRTKLGVKRVFKTNLLEDELYEGKIVD
GEFSIELRPFEVATYKLEL*
Coding >Ophcf2|00411
ATGCACTGCACCCTCTGCACGCACCCCATCGACCCGGCAGCCGCCGACTATAGCCTCGCACCGCCCTCCGACTCC
TCTCTCTCTCATCCTTATATTCCTCCTCCGGAATCTTCTCGCCATCGCCCTCTCCCTCTGGCCTTTCTTGACAGA
CACCTACGCCGTTCTATCAACAGATCAGACCCCGAATTTTATATCAACATGGGCGGCGGTGGACAAGCCAAGGGC
AACGGCTCTTACTCTGTTTTCGCCCGGAAACCCGTCGGCGTGCCCAAGACTAGCATTCTCAAGGACCGCATCGAG
CTCTTCTACAAGTCTGGCCAGTACGACAAGGTCAACCTGCTCGCCAACCTTTTCAAGGCCAGATATTCTGGGAAG
CCGCACGTCAAGCTCTACGTTTGGAGCGCCCCGGACCAGGAACGTCCGACCTTCAAGGAAGCTGTGTCCCATGAC
TTCAAGGAGACTGCCACTGGCGCCTCTTTCGGACCCTCGTGGTCGACTCACTGGTTCAGGATTCATCTGACGGTG
CCCAAGGACGCTCTTGACGAGGAGCTCGTCATTTTCGAATGGGATGCCGGCAACGAAGGCCTGGTCTGGGCCCCT
GATGGCACTCCCCTCCAGGGCCTCACGGGCGGAGGCGAGCGCATCGAATGGAACATGCCCAAGTCGTTCCGTGAT
GGCAAGGAGCATGTCATCTACATCGAAATGGCCTGCAACGGCATGTTCGGCAACGCGCCCAGCGGCAAGACCAGC
ATCGCCCCTCCGGACCCGAACCGCTACTACGCCCTGACCAAGGCCGACATCGCCGTTGTCAACGTGCCCGCCCGT
ATGCTGCACTTCGACATGTGGGAGCTCGGCGACGCCGCGCGGGAGCTTCCCGATACCTCGGCCGAGCAGAACAAG
GCCCTGGCGGTTGCCATGAAAATCATTGATACTTTCCAAGTTGACGACCAACAGTCCATTCTCGAGTGCCGCAAG
CTCGCTCGCGAAATCGTCGGCCCCGACGTCGATTCGCACAAGGTATACGAGGTCGGCAAGGACCCCGTCGTCTAC
GGCATCGGCCACTGTCACATCGACACGTGCTGGCTCTGGCCGTGGGCCGAGACGAAGCGAAAGATCTGTAGGTCC
TGGCTGAGCCAGTGTGATCTGATGGATCGCTACCCCGAGGCGCACTTTGCCTGCTCTTCGGCCCAGCAGTTCAAG
TGGCTAAAGGAATACTACCCCAGTGCCTTTGCGCGCGTCAAGACCAAGGTTTCGGACGGCCAGTTCCATCCCATC
GGCGGCAGCTGGGTCGAGCACGACACCAACATGCCGAGCGGCGAGTCGCTCGTTCGCCAGTTCTTCTACGGCCAG
AGGTTCTTTGAGGCCGAGTTCGGCTCCCGTTGCCGCACCTTTTGGCTGCCCGACACTTTTGGCTACTCGAGCCAG
CTCCCGCAGCTCTGTCGTCTCGCCGGCATGGAACGCTTCATGACGCAGAAGCTTAGCTGGAACAACATCAACACG
TTCCCGCACACGACGTTCATGTGGGTGAGTCCCGACGGCAGCCAGGTCATCTGTCACATGCCGCCCTCGGAGACG
TACACGTCCGACGCCAACTTTGGCGATCTCTCGCGGAGCATCTCCCAGCACAAGACGCTACGCGTCGACTCGTCG
TCCCTGCTGGTCTTTGGCAAGGGCGACGGCGGCGGAGGCCCGACCTGGCAGCACTTTGAGAAGCTCCGACGCTGC
GCCGGCATCAGCAACACCGTCGGTGCCATTCCCAAGCTCAAGCTGGGCCTCACCGTCGACGACTTCTTCGATCGG
CTGGCGCCCAAGGCAGGCGAGTTCCCGACCTGGCACGGCGAGCTGTACTTTGAGCTGCACCGCGGCACCTACACC
ACTCAGGCCAACAACAAGTTCTTCAACCGCAAGGCCGAGGTGATGCTCCGCGATATCGAGCAGCTGGCGACGTTC
GCGTCCATCAAGAGCGACAAGTACAGTTACCCGTCCAAGGAGATTGACGACATGTGGGAGGCTGTGCTGCTGTGC
CAGTTTCACGACTGTCTTCCGGGCAGCTCCATCGAGATGTGCTACGACGATTCGGACAAGCTGTACGCCGAGCTC
TTTAAGAAGGGGCAGGCGCTTCTCAAGGATCTCTACGGCCATCTGGGCGCCTCGGAGGAGCAGCCCATCGGTAGC
CTTGGCGGATCGGTCGCTCTCAACACTCTTCCCTGGCATCGCGAGGAAGTCGTTGAGGTGTCGGACACGGAGGTG
GGAATCGCCAGCGGAGACGGCCAGCTCCTCTCCCTGCGCACCTTGGAGGTTGCGGCGGACAAGCCGGCGGTGCGA
GTGACGGAGGAAGACAAGGACGCCTTCGTGTTGGAGAACGACCATCTCCGCGTCGTTGTCCAAGGCGGCTGCATC
ACGTCCCTCTACGATTGCGTCAACAAACGGGAGGTGGTGGAAAAAGGCGGCCAGGCCAACAAGTTTGTCATGTTT
GACGACATCCCGCTCTTCTGGGAGGCGTGGGATGTCGAAGTCTACCATCTCGAGACGGAGAGGCAGCTCACGTAC
GGCAAGACGAGGATTCACGAGAGCAAGCCGCACAAGGCGACGCTGGTGACGGACATCAAGGTCAGCGACAAGAGC
TCTCTCAAGGCCTACATCAGCCTCTCGGCAGCCGTCAAGGGTCGGACGTCGCAGGTGGACTGCTCTGCCGAGGTT
GACTGGCACGAGGACTCCAAGTTCCTCAAGGTCGAGTTCCCCGTCGACGTGGTCAACACGCAGGCGTCGTACGAA
TCGGCCTATACCATCACCAAGCGACCGACGCACTACAACACGAGCTGGGACATGGCCAAGTTCGAGGTGTGCTGC
CACCGCTTCGCCGATCTGTCGGAGAGCAACTACGGCGTTTCCATCCTCAACGACAGCAAGTACGGCTTCGCGACG
GTGGGCAAGATGATGCGGCTCTCGCTGCTGCGCGCTCCCAAGGCGCCCGACGCGCACGCCGACATGGGCCATCAC
TCGATGCGCTGGGCCATCTTCCCCCACGGGGGATGCCTCTCGTCGGAGACGGTCAGGGCCGCCTATGCCTTCAAC
AACCCGCTCAAGCTGCTGTCGGCGTCGGGCACTCTGCTCTGGTCGGAGGCGCCCATCACGTTGACCAACGTCGAG
GATTCTGCGTCGCTGGTGCTCGACTGCATCAAGCGCGGGCACGACGACGAGGACGTCAGCCGTTGCCAGGGACTG
CCCGTCGCCAAGGGCCGGAGCATCGTGCTGCGCGTGTACGAGTCGATGGGAGGCCGGAGCAGGGGTACGATCCGT
ACCAAGCTGGGCGTGAAGCGCGTCTTCAAGACGAACTTGCTGGAGGACGAGCTGTACGAGGGCAAGATTGTCGAC
GGGGAGTTTAGCATTGAGTTGCGACCGTTTGAGGTGGCGACATACAAGCTGGAGCTCTAG
Transcript >Ophcf2|00411
ATGCACTGCACCCTCTGCACGCACCCCATCGACCCGGCAGCCGCCGACTATAGCCTCGCACCGCCCTCCGACTCC
TCTCTCTCTCATCCTTATATTCCTCCTCCGGAATCTTCTCGCCATCGCCCTCTCCCTCTGGCCTTTCTTGACAGA
CACCTACGCCGTTCTATCAACAGATCAGACCCCGAATTTTATATCAACATGGGCGGCGGTGGACAAGCCAAGGGC
AACGGCTCTTACTCTGTTTTCGCCCGGAAACCCGTCGGCGTGCCCAAGACTAGCATTCTCAAGGACCGCATCGAG
CTCTTCTACAAGTCTGGCCAGTACGACAAGGTCAACCTGCTCGCCAACCTTTTCAAGGCCAGATATTCTGGGAAG
CCGCACGTCAAGCTCTACGTTTGGAGCGCCCCGGACCAGGAACGTCCGACCTTCAAGGAAGCTGTGTCCCATGAC
TTCAAGGAGACTGCCACTGGCGCCTCTTTCGGACCCTCGTGGTCGACTCACTGGTTCAGGATTCATCTGACGGTG
CCCAAGGACGCTCTTGACGAGGAGCTCGTCATTTTCGAATGGGATGCCGGCAACGAAGGCCTGGTCTGGGCCCCT
GATGGCACTCCCCTCCAGGGCCTCACGGGCGGAGGCGAGCGCATCGAATGGAACATGCCCAAGTCGTTCCGTGAT
GGCAAGGAGCATGTCATCTACATCGAAATGGCCTGCAACGGCATGTTCGGCAACGCGCCCAGCGGCAAGACCAGC
ATCGCCCCTCCGGACCCGAACCGCTACTACGCCCTGACCAAGGCCGACATCGCCGTTGTCAACGTGCCCGCCCGT
ATGCTGCACTTCGACATGTGGGAGCTCGGCGACGCCGCGCGGGAGCTTCCCGATACCTCGGCCGAGCAGAACAAG
GCCCTGGCGGTTGCCATGAAAATCATTGATACTTTCCAAGTTGACGACCAACAGTCCATTCTCGAGTGCCGCAAG
CTCGCTCGCGAAATCGTCGGCCCCGACGTCGATTCGCACAAGGTATACGAGGTCGGCAAGGACCCCGTCGTCTAC
GGCATCGGCCACTGTCACATCGACACGTGCTGGCTCTGGCCGTGGGCCGAGACGAAGCGAAAGATCTGTAGGTCC
TGGCTGAGCCAGTGTGATCTGATGGATCGCTACCCCGAGGCGCACTTTGCCTGCTCTTCGGCCCAGCAGTTCAAG
TGGCTAAAGGAATACTACCCCAGTGCCTTTGCGCGCGTCAAGACCAAGGTTTCGGACGGCCAGTTCCATCCCATC
GGCGGCAGCTGGGTCGAGCACGACACCAACATGCCGAGCGGCGAGTCGCTCGTTCGCCAGTTCTTCTACGGCCAG
AGGTTCTTTGAGGCCGAGTTCGGCTCCCGTTGCCGCACCTTTTGGCTGCCCGACACTTTTGGCTACTCGAGCCAG
CTCCCGCAGCTCTGTCGTCTCGCCGGCATGGAACGCTTCATGACGCAGAAGCTTAGCTGGAACAACATCAACACG
TTCCCGCACACGACGTTCATGTGGGTGAGTCCCGACGGCAGCCAGGTCATCTGTCACATGCCGCCCTCGGAGACG
TACACGTCCGACGCCAACTTTGGCGATCTCTCGCGGAGCATCTCCCAGCACAAGACGCTACGCGTCGACTCGTCG
TCCCTGCTGGTCTTTGGCAAGGGCGACGGCGGCGGAGGCCCGACCTGGCAGCACTTTGAGAAGCTCCGACGCTGC
GCCGGCATCAGCAACACCGTCGGTGCCATTCCCAAGCTCAAGCTGGGCCTCACCGTCGACGACTTCTTCGATCGG
CTGGCGCCCAAGGCAGGCGAGTTCCCGACCTGGCACGGCGAGCTGTACTTTGAGCTGCACCGCGGCACCTACACC
ACTCAGGCCAACAACAAGTTCTTCAACCGCAAGGCCGAGGTGATGCTCCGCGATATCGAGCAGCTGGCGACGTTC
GCGTCCATCAAGAGCGACAAGTACAGTTACCCGTCCAAGGAGATTGACGACATGTGGGAGGCTGTGCTGCTGTGC
CAGTTTCACGACTGTCTTCCGGGCAGCTCCATCGAGATGTGCTACGACGATTCGGACAAGCTGTACGCCGAGCTC
TTTAAGAAGGGGCAGGCGCTTCTCAAGGATCTCTACGGCCATCTGGGCGCCTCGGAGGAGCAGCCCATCGGTAGC
CTTGGCGGATCGGTCGCTCTCAACACTCTTCCCTGGCATCGCGAGGAAGTCGTTGAGGTGTCGGACACGGAGGTG
GGAATCGCCAGCGGAGACGGCCAGCTCCTCTCCCTGCGCACCTTGGAGGTTGCGGCGGACAAGCCGGCGGTGCGA
GTGACGGAGGAAGACAAGGACGCCTTCGTGTTGGAGAACGACCATCTCCGCGTCGTTGTCCAAGGCGGCTGCATC
ACGTCCCTCTACGATTGCGTCAACAAACGGGAGGTGGTGGAAAAAGGCGGCCAGGCCAACAAGTTTGTCATGTTT
GACGACATCCCGCTCTTCTGGGAGGCGTGGGATGTCGAAGTCTACCATCTCGAGACGGAGAGGCAGCTCACGTAC
GGCAAGACGAGGATTCACGAGAGCAAGCCGCACAAGGCGACGCTGGTGACGGACATCAAGGTCAGCGACAAGAGC
TCTCTCAAGGCCTACATCAGCCTCTCGGCAGCCGTCAAGGGTCGGACGTCGCAGGTGGACTGCTCTGCCGAGGTT
GACTGGCACGAGGACTCCAAGTTCCTCAAGGTCGAGTTCCCCGTCGACGTGGTCAACACGCAGGCGTCGTACGAA
TCGGCCTATACCATCACCAAGCGACCGACGCACTACAACACGAGCTGGGACATGGCCAAGTTCGAGGTGTGCTGC
CACCGCTTCGCCGATCTGTCGGAGAGCAACTACGGCGTTTCCATCCTCAACGACAGCAAGTACGGCTTCGCGACG
GTGGGCAAGATGATGCGGCTCTCGCTGCTGCGCGCTCCCAAGGCGCCCGACGCGCACGCCGACATGGGCCATCAC
TCGATGCGCTGGGCCATCTTCCCCCACGGGGGATGCCTCTCGTCGGAGACGGTCAGGGCCGCCTATGCCTTCAAC
AACCCGCTCAAGCTGCTGTCGGCGTCGGGCACTCTGCTCTGGTCGGAGGCGCCCATCACGTTGACCAACGTCGAG
GATTCTGCGTCGCTGGTGCTCGACTGCATCAAGCGCGGGCACGACGACGAGGACGTCAGCCGTTGCCAGGGACTG
CCCGTCGCCAAGGGCCGGAGCATCGTGCTGCGCGTGTACGAGTCGATGGGAGGCCGGAGCAGGGGTACGATCCGT
ACCAAGCTGGGCGTGAAGCGCGTCTTCAAGACGAACTTGCTGGAGGACGAGCTGTACGAGGGCAAGATTGTCGAC
GGGGAGTTTAGCATTGAGTTGCGACCGTTTGAGGTGGCGACATACAAGCTGGAGCTCTAG
Gene >Ophcf2|00411
ATGCACTGCACCCTGTCCGCCACAATCCCCGCCCGCTAAGCCGCAATACCGGAGTTCCTCGACAGCTTCCCCTCC
TTCTCCCTTTCATCTTCTGCCAGCTGACGATTTAAGCTGCACGCACCCCATGTACGCTACCCATTACAATTATTT
TCCAGGCACATTAACCCAAGCTTTCCTTCTCCCGCAGACTGTGACTGCAACCTCGTTCAGCCCTGCCACCTGCTG
ATCTTGTTTCAGCGACCCGGCAGCCGCCGACTATAGCCTCGCACCGCCCTCCGACTCCTCTCTCTCTCATCCTTA
TATTCCTCCTCCGGAATCTTCTCGCCATCGCCCTCTCCCTCTGGCCTTTCTTGACAGACACCTACGCCGTTCTAT
CAACAGATCAGACCCCGAATTTTATATCAACATGGGCGGCGGTGGACAAGCCAAGGGCAACGGCTCTTACTCTGT
TTTCGCCCGGAAACCCGTCGGCGTGCCCAAGACTAGCATTCTCAAGGACCGCATCGAGCTCTTCTACAAGTCTGG
CCAGTACGACAAGGTCAACCTGCTCGCGTGAGTGTACCATGGTCCATCTCTCCTGTATGCCATCCCTCATGCTGA
CCTTTTGACGTCTTTAGCAACCTTTTCAAGGCCAGATATTCTGGGAAGCCGCACGTCAAGCTCTACGTTTGGAGC
GCCCCGGACCAGGAACGTCCGACCTTCAAGGAAGCTGTGTCCCATGACTTCAAGGAGACTGCCACTGGCGCCTCT
TTCGGACCCTCGTGGTCGACTCACTGGTTCAGGATTCATCTGACGGTGCCCAAGGACGCTCTTGACGAGGAGCTC
GTCATTTTCGAATGGGATGCCGGCAACGAAGGCCTGGTCTGGGCCCCTGATGGCACTCCCCTCCAGGGCCTCACG
GGCGGAGGCGAGCGCATCGAATGGAACATGCCCAAGTCGTTCCGTGATGGCAAGGAGCATGTCATCTACATCGAA
ATGGCCTGCAACGGCATGTTCGGCAACGCGCCCAGCGGCAAGACCAGCATCGCCCCTCCGGACCCGAACCGCTAC
TACGCCCTGACCAAGGCCGACATCGCCGTTGTCAACGTGCCCGCCCGTATGCTGCACTTCGACATGTGGGAGCTC
GGCGACGCCGCGCGGGAGCTTCCCGATACCTCGGCCGAGCAGAACAAGGCCCTGGCGGTTGCCATGAAAATCATT
GATACTTTCCAAGTTGACGACCAACAGTCCATTCTCGAGTGCCGCAAGCTCGCTCGCGAAATCGTCGGCCCCGAC
GTCGATTCGCACAAGGTATACGAGGTCGGCAAGGACCCCGTCGTCTACGGCATCGGCCACTGTCACATCGACACG
TGCTGGCTCTGGCCGTGGGCCGAGACGAAGCGAAAGATCTGTAGGTCCTGGCTGAGCCAGTGTGATCTGATGGAT
CGCTACCCCGAGGCGCACTTTGCCTGCTCTTCGGCCCAGCAGTTCAAGTGGCTAAAGGAATACTACCCCAGTGCC
TTTGCGCGCGTCAAGACCAAGGTTTCGGACGGCCAGTTCCATCCCATCGGCGGCAGCTGGGTCGAGCACGACACC
AACATGCCGAGCGGCGAGTCGCTCGTTCGCCAGTTCTTCTACGGCCAGAGGTTCTTTGAGGCCGAGTTCGGCTCC
CGTTGCCGCACCTTTTGGCTGCCCGACACTTTTGGCTACTCGAGCCAGCTCCCGCAGCTCTGTCGTCTCGCCGGC
ATGGAACGCTTCATGACGCAGAAGCTTAGCTGGAACAACATCAACACGTTCCCGCACACGACGTTCATGTGGGTG
AGTCCCGACGGCAGCCAGGTCATCTGTCACATGCCGCCCTCGGAGACGTACACGTCCGACGCCAACTTTGGCGAT
CTCTCGCGGAGCATCTCCCAGCACAAGACGCTACGCGTCGACTCGTCGTCCCTGCTGGTCTTTGGCAAGGGCGAC
GGCGGCGGAGGCCCGACCTGGCAGCACTTTGAGAAGCTCCGACGCTGCGCCGGCATCAGCAACACCGTCGGTGCC
ATTCCCAAGCTCAAGCTGGGCCTCACCGTCGACGACTTCTTCGATCGGCTGGCGCCCAAGGCAGGCGAGTTCCCG
ACCTGGCACGGCGAGCTGTACTTTGAGCTGCACCGCGGCACCTACACCACTCAGGCCAACAACAAGTTCTTCAAC
CGCAAGGCCGAGGTGATGCTCCGCGATATCGAGCAGCTGGCGACGTTCGCGTCCATCAAGAGCGACAAGTACAGT
TACCCGTCCAAGGAGATTGACGACATGTGGGAGGCTGTGCTGCTGTGCCAGTTTCACGACTGTCTTCCGGGCAGC
TCCATCGAGATGTGCTACGACGATTCGGACAAGGTAAGTCAGAGTCGTTCCCAGTGCAAGATGCTCGTGGCTTAT
GATTACGGATGGCAGCTGTACGCCGAGCTCTTTAAGAAGGGGCAGGCGCTTCTCAAGGATCTCTACGGCCATCTG
GGCGCCTCGGAGGAGCAGCCCATCGGTAGCCTTGGCGGATCGGTCGCTCTCAACACTCTTCCCTGGCATCGCGAG
GAAGTCGTTGAGGTGTCGGACACGGAGGTGGGAATCGCCAGCGGAGACGGCCAGCTCCTCTCCCTGCGCACCTTG
GAGGTTGCGGCGGACAAGCCGGCGGTGCGAGTGACGGAGGAAGACAAGGACGCCTTCGTGTTGGAGAACGACCAT
CTCCGCGTCGTTGTCCAAGGCGGCTGCATCACGTCCCTCTACGATTGCGTCAACAAACGGGAGGTGGTGGAAAAA
GGCGGCCAGGCCAACAAGTTTGTCATGTTTGACGACATCCCGCTCTTCTGGGAGGCGTGGGATGTCGAAGTCTAC
CATCTCGAGACGGAGAGGCAGCTCACGTACGGCAAGACGAGGATTCACGAGAGCAAGCCGCACAAGGCGACGCTG
GTGACGGACATCAAGGTCAGCGACAAGAGCTCTCTCAAGGCCTACATCAGCCTCTCGGCAGCCGTCAAGGGTCGG
ACGTCGCAGGTGGACTGCTCTGCCGAGGTTGACTGGCACGAGGACTCCAAGTTCCTCAAGGTCGAGTTCCCCGTC
GACGTGGTCAACACGCAGGCGTCGTACGAATCGGCCTATACCATCACCAAGCGACCGACGCACTACAACACGAGC
TGGGACATGGCCAAGTTCGAGGTGTGCTGCCACCGCTTCGCCGATCTGTCGGAGAGCAACTACGGCGTTTCCATC
CTCAACGACAGCAAGTACGGCTTCGCGACGGTGGGCAAGATGATGCGGCTCTCGCTGCTGCGCGCTCCCAAGGCG
CCCGACGCGCACGCCGACATGGGCCATCACTCGATGCGCTGGGCCATCTTCCCCCACGGGGGATGCCTCTCGTCG
GAGACGGTCAGGGCCGCCTATGCCTTCAACAACCCGCTCAAGCTGCTGTCGGCGTCGGGCACTCTGCTCTGGTCG
GAGGCGCCCATCACGTTGACCAACGTCGAGGATTCTGCGTCGCTGGTGCTCGACTGCATCAAGCGCGGGCACGAC
GACGAGGACGTCAGCCGTTGCCAGGGACTGCCCGTCGCCAAGGGCCGGAGCATCGTGCTGCGCGTGTACGAGTCG
ATGGGAGGCCGGAGCAGGGGTACGATCCGTACCAAGCTGGGCGTGAAGCGCGTCTTCAAGACGAACTTGCTGGAG
GACGAGCTGTACGAGGGCAAGATTGTCGACGGGGAGTTTAGCATTGAGTTGCGACCGTTTGAGGTGGCGACATAC
AAGCTGGAGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail