Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00409
Gene name
Locationscaffold_01:1713948..1719401
Strand+
Gene length (bp)5453
Transcript length (bp)4611
Coding sequence length (bp)4611
Protein length (aa) 1537

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 1.6E-20 1007 1099
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 1.2E-16 1017 1121
PF01426 BAH BAH domain 1.7E-14 163 271
PF13831 PHD_2 PHD-finger 1.2E-07 899 929

GO

GO Term Description Terminal node
GO:0003682 chromatin binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2085 0.9535 0.0636 0.0196 0.0645 0.0174 0.0251 0.0123 0.0262 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4416
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6078
Ophiocordyceps australis map64 (Brazil) OphauB2|4049
Ophiocordyceps camponoti-floridani Ophcf2|00409 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7084
Ophiocordyceps kimflemingae Ophio5|6355
Ophiocordyceps subramaniannii Hirsu2|9145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00409
MAPQNASKEPEPESTTAKDVSSSLHGTRSSRKIVRPNYAEDKDIDMDNYDFYRENKRPGRHAVTGPDRGGGRRST
GGDSRMSETDGQDGGGSCGSGTGGGAPVSAAAVSHMSRKRKAAKRAGNAAQTPAATTAPLRDTNMMTFEQCSSRP
DQGRMTADDGTVLEPNDHVYLVCEPPGEPYYLGRIMEFLHAQNDSARCVEAVRINWFYRPKDIGRKPLDTRQVYA
TMHSDISPLTALRGKCHIKHRCEIDNFDQFRKTPDSFWFDKLYDRYIQKNYDLIQTASIVNVPDKVKKMLDERWK
FVLVEQGRGKELTSAVKLCKRCSGYCARGRFNDSVDCAVCHNTYHMNCVRPPLLKKPSRGFAWSCAACSRAQERK
LEARDTPNGAESGAPAEDEEFPDDEDDEGQGIATDRTTPAEDAPHHQGTPEQVYRASLWPWRYLGMHCKPEDALD
YDDRIYPRASTRIGPRHQANVGPWPGRPVQYVKPIETKKGSKGQKMNKEAQDAEKAAKGKRPKWVQDQPPGYVAR
GEDYDDGDSRATATLLWKPPPPDSSISVKAMEEYDDATQAMAKKLGLPPRSTNLRDAAVETLFRHDYDVSDALKA
VPEMQREAFKEPNPSATEHKKFEEAVSKYGSELHQVKKHVKTMTHGAVVRYYYTWKKTDRGQQLWGSFSGRKGKK
QAKRADAAANKFADDVADNDDDSAFDTGKAAEKKRSFVCQFCSTTTSRQWRRAPNIAPGVPSDHGARSGGKDKSG
GQCVVALCRRCAELWRRYGVRFEEMDEGGKKAAQSGGRASKRKQDEELLKQQQAAQEVSLTTPDRDNTPQSVPAP
AVSQEPPRKKLKGAPSDREPDQACSDGGGSGSTPSLPKKKEKAADATPVPEMPKPRTLPCAICHQLEPQGDQHLS
CRECRLTVHRNCYGIMDNRIQGKWICDMCSNDKSPQVSIQYKCVLCPVEHTEWDFVEQPKLTHHKKKMSEKDRGR
EKMEVQQARKAAEFYRKKQEEMNRPVNPREPLKRTADNNWVHVTCAVWTPEVKFGNAKALEPSEGIPSIPRSRYD
ETCQACSQKGGACIFCHHCRVPYHVECARQQGHLLGFDITPVKSSRRDQFNMVTVKGESGTMSAVMWCKDHVPTK
TMAHRMDETAGGSGLNALQLYVQNYKQADLTLTGTVRKANLMMNAAKTSSAPPVQVPRRTSASGGPPGTVNGRAR
SNEAAEAASNSPQQAGEKVCITCGVDVTPKWWPIDDSLGRRLTNGHHGAIGSEAQKFVEQRRFQCHKCRKAACPP
MPYSSPPRYREASSSNGGQGAGVSPPVDYRHELHALLHHPASHAPMTVVAQPHHGPTHVMGPRPTTAVSLPYVAA
PPSRHGHYNDWSHQQPPGPRHGSPARHLNGGPPPLHGGPPSGPPGPPGPPPPPAMSSLSSLRPPAMSGPPPPMAH
HHSPMYGSGMPVSPRRMSGPTHPAAYVPPYHGPAAHGASPRLSNGVPPPPRTETFSHGLHPQRSPYSGSPPLPRS
GLQPGPHENGSKVESSQANKPASGASASPSLRNLLS*
Coding >Ophcf2|00409
ATGGCACCGCAAAATGCCTCCAAGGAGCCCGAGCCCGAGTCGACCACGGCCAAGGACGTGTCGTCTTCGCTCCAC
GGAACTCGGTCGTCGCGCAAAATTGTGCGTCCCAATTACGCCGAGGACAAGGACATTGACATGGATAATTACGAT
TTCTACCGCGAAAACAAGCGTCCGGGCCGGCATGCGGTTACCGGGCCCGACCGCGGAGGAGGGCGCAGGTCAACC
GGGGGCGACTCGAGGATGAGTGAAACCGACGGCCAGGACGGCGGCGGTTCCTGTGGGAGCGGGACCGGCGGCGGC
GCTCCTGTCTCCGCAGCGGCTGTGTCGCACATGTCGCGCAAACGCAAGGCGGCCAAGCGGGCTGGAAATGCGGCG
CAGACGCCGGCGGCCACGACGGCGCCGTTGCGAGACACCAACATGATGACCTTTGAGCAGTGCAGCTCGCGCCCG
GACCAGGGGCGCATGACGGCTGACGACGGCACCGTGCTAGAGCCGAATGATCACGTCTACCTGGTGTGCGAGCCG
CCCGGAGAGCCCTACTATCTTGGTCGCATCATGGAGTTTCTGCACGCCCAAAACGATAGCGCCCGCTGCGTCGAG
GCTGTCCGAATCAACTGGTTCTACCGGCCCAAGGACATTGGCCGCAAGCCCCTCGACACCCGCCAGGTCTATGCC
ACGATGCATTCCGACATTAGTCCGCTGACGGCCCTGCGCGGCAAATGCCACATCAAGCACCGCTGTGAGATTGAC
AATTTTGACCAGTTCCGCAAGACGCCCGACTCCTTCTGGTTCGACAAGCTGTACGACCGCTACATTCAAAAGAAC
TACGACCTGATCCAGACGGCCAGCATTGTCAACGTCCCGGACAAGGTTAAGAAGATGCTCGATGAGCGCTGGAAG
TTTGTCTTGGTGGAGCAGGGCCGTGGGAAGGAGCTCACGAGCGCCGTTAAGCTCTGCAAGAGGTGCAGCGGCTAC
TGTGCGAGGGGTCGATTCAACGATTCGGTCGATTGTGCCGTCTGCCACAACACCTATCACATGAACTGCGTCAGG
CCTCCCCTGTTAAAAAAGCCCTCACGAGGCTTCGCCTGGTCCTGCGCTGCCTGCAGCAGAGCTCAGGAACGCAAG
CTCGAGGCTCGCGACACGCCCAACGGTGCCGAATCTGGCGCCCCGGCCGAGGACGAAGAGTTCCCCGACGACGAG
GACGACGAGGGCCAGGGCATCGCCACCGACCGCACCACGCCTGCCGAAGACGCACCCCATCACCAGGGCACCCCC
GAGCAAGTCTACCGCGCCAGCCTGTGGCCTTGGCGCTACCTGGGCATGCATTGCAAGCCCGAAGACGCCCTCGAC
TACGACGACCGCATCTATCCCCGTGCCAGCACCCGCATCGGTCCCCGCCATCAGGCCAACGTCGGCCCCTGGCCG
GGCCGTCCGGTGCAGTATGTGAAGCCTATCGAGACAAAGAAGGGCTCCAAGGGTCAAAAGATGAACAAGGAGGCT
CAGGACGCGGAAAAGGCCGCCAAGGGCAAGCGGCCCAAATGGGTCCAGGACCAGCCTCCCGGTTACGTCGCCCGC
GGAGAGGACTATGATGACGGCGACTCCAGGGCCACGGCGACGCTCCTATGGAAGCCTCCTCCGCCCGACAGCTCG
ATTTCGGTCAAGGCAATGGAGGAATACGACGACGCGACGCAGGCCATGGCCAAGAAGCTCGGCCTGCCACCCCGT
TCGACGAACCTCCGAGACGCGGCAGTGGAGACGCTGTTCCGTCACGACTACGACGTTTCCGATGCTCTCAAGGCC
GTTCCGGAGATGCAGCGGGAGGCCTTCAAAGAGCCGAACCCAAGCGCGACGGAGCACAAGAAGTTCGAAGAGGCC
GTATCCAAGTATGGGTCCGAGCTGCACCAGGTCAAGAAGCACGTCAAGACCATGACGCACGGCGCCGTCGTTCGC
TACTACTATACCTGGAAGAAGACGGATCGTGGGCAGCAGCTCTGGGGCAGCTTCTCTGGACGCAAGGGCAAGAAG
CAGGCCAAGAGGGCCGACGCAGCCGCCAACAAGTTCGCCGACGATGTGGCGGACAACGACGACGACTCGGCCTTT
GACACGGGTAAGGCGGCCGAGAAGAAGCGCAGTTTCGTATGCCAGTTCTGCTCCACGACGACGTCTCGTCAGTGG
CGGAGGGCGCCTAACATAGCGCCGGGCGTCCCCAGCGATCACGGAGCCCGATCCGGCGGCAAGGACAAGAGCGGC
GGGCAGTGCGTCGTGGCTCTCTGCCGGAGGTGCGCCGAGCTGTGGCGGCGCTACGGCGTCCGGTTCGAGGAAATG
GACGAGGGCGGCAAGAAGGCGGCTCAGTCGGGTGGCAGAGCCTCGAAGCGTAAGCAGGACGAAGAGCTCCTCAAG
CAGCAGCAAGCCGCCCAGGAGGTGAGCCTGACGACTCCGGACCGCGACAACACGCCCCAGAGCGTTCCCGCGCCG
GCCGTCAGCCAGGAACCGCCCCGGAAGAAGCTCAAGGGAGCCCCGTCGGACAGGGAGCCGGATCAGGCATGTTCA
GACGGAGGTGGCAGCGGATCGACGCCCAGCCTTCCCAAGAAGAAGGAAAAGGCGGCGGATGCGACGCCGGTGCCG
GAGATGCCGAAGCCGCGAACGCTGCCGTGCGCCATCTGCCATCAGCTGGAGCCCCAGGGAGACCAGCATCTGTCT
TGTCGAGAGTGCCGGCTGACGGTGCACCGTAACTGCTACGGCATCATGGACAATCGAATTCAGGGGAAATGGATC
TGCGACATGTGCTCCAACGACAAGAGCCCGCAGGTTTCCATCCAATACAAATGCGTCCTCTGTCCCGTCGAGCAC
ACTGAATGGGACTTTGTCGAGCAGCCCAAGCTCACTCACCACAAGAAGAAGATGTCGGAAAAGGATCGAGGGCGG
GAGAAGATGGAGGTGCAGCAGGCCCGCAAGGCTGCCGAGTTCTATCGCAAGAAGCAGGAGGAGATGAACCGGCCG
GTGAATCCGAGAGAGCCCCTGAAGCGGACGGCCGACAACAACTGGGTGCACGTCACGTGCGCCGTCTGGACGCCC
GAGGTCAAGTTCGGCAACGCAAAGGCGCTGGAGCCGTCGGAGGGGATCCCGTCGATCCCGAGGTCGAGATACGAC
GAGACGTGCCAGGCTTGCAGCCAGAAGGGCGGCGCGTGCATCTTTTGTCATCACTGCCGCGTTCCGTATCACGTC
GAGTGTGCGCGTCAACAGGGTCACCTGCTCGGGTTCGACATTACGCCGGTCAAGAGCTCGCGGCGCGACCAGTTC
AACATGGTGACGGTCAAGGGAGAGAGCGGCACCATGTCAGCCGTCATGTGGTGCAAAGACCACGTGCCGACCAAG
ACGATGGCGCACCGGATGGACGAGACGGCGGGCGGTTCCGGCCTGAACGCGCTGCAGCTCTACGTGCAGAACTAC
AAGCAGGCGGACCTGACGCTGACTGGCACCGTCCGCAAGGCCAATCTGATGATGAACGCGGCCAAGACGTCGTCG
GCGCCCCCCGTCCAGGTGCCGCGGCGGACGTCGGCCAGCGGAGGGCCTCCCGGGACCGTCAACGGGCGGGCGCGC
AGCAACGAGGCGGCCGAAGCGGCATCAAACAGCCCGCAGCAGGCGGGAGAGAAGGTGTGCATCACGTGTGGCGTC
GACGTGACGCCCAAGTGGTGGCCCATCGACGACTCTCTCGGCCGGCGGCTCACCAACGGACACCATGGCGCTATC
GGCTCCGAGGCGCAGAAGTTTGTCGAGCAGCGGCGATTCCAGTGTCACAAGTGCCGCAAGGCCGCCTGCCCTCCG
ATGCCGTACTCGTCGCCCCCACGTTATCGCGAGGCGAGCAGTAGCAACGGCGGCCAGGGAGCCGGAGTCTCGCCC
CCCGTCGACTATCGTCACGAGCTTCACGCCTTGTTGCACCATCCGGCCTCTCACGCCCCCATGACCGTCGTGGCA
CAACCGCACCACGGACCGACCCATGTCATGGGACCGAGGCCGACGACGGCTGTTTCGCTGCCGTACGTGGCCGCG
CCGCCTTCCCGGCACGGACACTACAATGATTGGAGCCACCAGCAGCCGCCGGGGCCAAGGCACGGGTCGCCGGCG
CGCCACCTCAACGGGGGGCCGCCGCCGCTGCATGGCGGACCTCCTTCCGGTCCTCCCGGCCCGCCCGGTCCGCCA
CCTCCACCGGCCATGTCGAGCCTCTCATCGCTCCGACCGCCGGCCATGTCGGGGCCGCCTCCACCCATGGCTCAC
CACCACTCGCCCATGTACGGCAGCGGCATGCCCGTGTCTCCCCGACGGATGAGCGGGCCCACGCACCCGGCAGCA
TACGTTCCTCCGTACCACGGGCCGGCTGCTCACGGCGCGTCGCCGAGGCTGAGCAACGGAGTGCCGCCGCCCCCG
CGAACGGAGACGTTTTCGCACGGGCTGCACCCGCAGCGATCGCCGTATTCGGGGAGTCCGCCGCTGCCTCGGAGC
GGACTACAACCGGGACCTCACGAGAACGGAAGCAAAGTGGAGAGCTCGCAGGCAAACAAGCCGGCCAGCGGGGCC
AGTGCGAGCCCGTCGCTGCGCAATCTGCTGTCGTGA
Transcript >Ophcf2|00409
ATGGCACCGCAAAATGCCTCCAAGGAGCCCGAGCCCGAGTCGACCACGGCCAAGGACGTGTCGTCTTCGCTCCAC
GGAACTCGGTCGTCGCGCAAAATTGTGCGTCCCAATTACGCCGAGGACAAGGACATTGACATGGATAATTACGAT
TTCTACCGCGAAAACAAGCGTCCGGGCCGGCATGCGGTTACCGGGCCCGACCGCGGAGGAGGGCGCAGGTCAACC
GGGGGCGACTCGAGGATGAGTGAAACCGACGGCCAGGACGGCGGCGGTTCCTGTGGGAGCGGGACCGGCGGCGGC
GCTCCTGTCTCCGCAGCGGCTGTGTCGCACATGTCGCGCAAACGCAAGGCGGCCAAGCGGGCTGGAAATGCGGCG
CAGACGCCGGCGGCCACGACGGCGCCGTTGCGAGACACCAACATGATGACCTTTGAGCAGTGCAGCTCGCGCCCG
GACCAGGGGCGCATGACGGCTGACGACGGCACCGTGCTAGAGCCGAATGATCACGTCTACCTGGTGTGCGAGCCG
CCCGGAGAGCCCTACTATCTTGGTCGCATCATGGAGTTTCTGCACGCCCAAAACGATAGCGCCCGCTGCGTCGAG
GCTGTCCGAATCAACTGGTTCTACCGGCCCAAGGACATTGGCCGCAAGCCCCTCGACACCCGCCAGGTCTATGCC
ACGATGCATTCCGACATTAGTCCGCTGACGGCCCTGCGCGGCAAATGCCACATCAAGCACCGCTGTGAGATTGAC
AATTTTGACCAGTTCCGCAAGACGCCCGACTCCTTCTGGTTCGACAAGCTGTACGACCGCTACATTCAAAAGAAC
TACGACCTGATCCAGACGGCCAGCATTGTCAACGTCCCGGACAAGGTTAAGAAGATGCTCGATGAGCGCTGGAAG
TTTGTCTTGGTGGAGCAGGGCCGTGGGAAGGAGCTCACGAGCGCCGTTAAGCTCTGCAAGAGGTGCAGCGGCTAC
TGTGCGAGGGGTCGATTCAACGATTCGGTCGATTGTGCCGTCTGCCACAACACCTATCACATGAACTGCGTCAGG
CCTCCCCTGTTAAAAAAGCCCTCACGAGGCTTCGCCTGGTCCTGCGCTGCCTGCAGCAGAGCTCAGGAACGCAAG
CTCGAGGCTCGCGACACGCCCAACGGTGCCGAATCTGGCGCCCCGGCCGAGGACGAAGAGTTCCCCGACGACGAG
GACGACGAGGGCCAGGGCATCGCCACCGACCGCACCACGCCTGCCGAAGACGCACCCCATCACCAGGGCACCCCC
GAGCAAGTCTACCGCGCCAGCCTGTGGCCTTGGCGCTACCTGGGCATGCATTGCAAGCCCGAAGACGCCCTCGAC
TACGACGACCGCATCTATCCCCGTGCCAGCACCCGCATCGGTCCCCGCCATCAGGCCAACGTCGGCCCCTGGCCG
GGCCGTCCGGTGCAGTATGTGAAGCCTATCGAGACAAAGAAGGGCTCCAAGGGTCAAAAGATGAACAAGGAGGCT
CAGGACGCGGAAAAGGCCGCCAAGGGCAAGCGGCCCAAATGGGTCCAGGACCAGCCTCCCGGTTACGTCGCCCGC
GGAGAGGACTATGATGACGGCGACTCCAGGGCCACGGCGACGCTCCTATGGAAGCCTCCTCCGCCCGACAGCTCG
ATTTCGGTCAAGGCAATGGAGGAATACGACGACGCGACGCAGGCCATGGCCAAGAAGCTCGGCCTGCCACCCCGT
TCGACGAACCTCCGAGACGCGGCAGTGGAGACGCTGTTCCGTCACGACTACGACGTTTCCGATGCTCTCAAGGCC
GTTCCGGAGATGCAGCGGGAGGCCTTCAAAGAGCCGAACCCAAGCGCGACGGAGCACAAGAAGTTCGAAGAGGCC
GTATCCAAGTATGGGTCCGAGCTGCACCAGGTCAAGAAGCACGTCAAGACCATGACGCACGGCGCCGTCGTTCGC
TACTACTATACCTGGAAGAAGACGGATCGTGGGCAGCAGCTCTGGGGCAGCTTCTCTGGACGCAAGGGCAAGAAG
CAGGCCAAGAGGGCCGACGCAGCCGCCAACAAGTTCGCCGACGATGTGGCGGACAACGACGACGACTCGGCCTTT
GACACGGGTAAGGCGGCCGAGAAGAAGCGCAGTTTCGTATGCCAGTTCTGCTCCACGACGACGTCTCGTCAGTGG
CGGAGGGCGCCTAACATAGCGCCGGGCGTCCCCAGCGATCACGGAGCCCGATCCGGCGGCAAGGACAAGAGCGGC
GGGCAGTGCGTCGTGGCTCTCTGCCGGAGGTGCGCCGAGCTGTGGCGGCGCTACGGCGTCCGGTTCGAGGAAATG
GACGAGGGCGGCAAGAAGGCGGCTCAGTCGGGTGGCAGAGCCTCGAAGCGTAAGCAGGACGAAGAGCTCCTCAAG
CAGCAGCAAGCCGCCCAGGAGGTGAGCCTGACGACTCCGGACCGCGACAACACGCCCCAGAGCGTTCCCGCGCCG
GCCGTCAGCCAGGAACCGCCCCGGAAGAAGCTCAAGGGAGCCCCGTCGGACAGGGAGCCGGATCAGGCATGTTCA
GACGGAGGTGGCAGCGGATCGACGCCCAGCCTTCCCAAGAAGAAGGAAAAGGCGGCGGATGCGACGCCGGTGCCG
GAGATGCCGAAGCCGCGAACGCTGCCGTGCGCCATCTGCCATCAGCTGGAGCCCCAGGGAGACCAGCATCTGTCT
TGTCGAGAGTGCCGGCTGACGGTGCACCGTAACTGCTACGGCATCATGGACAATCGAATTCAGGGGAAATGGATC
TGCGACATGTGCTCCAACGACAAGAGCCCGCAGGTTTCCATCCAATACAAATGCGTCCTCTGTCCCGTCGAGCAC
ACTGAATGGGACTTTGTCGAGCAGCCCAAGCTCACTCACCACAAGAAGAAGATGTCGGAAAAGGATCGAGGGCGG
GAGAAGATGGAGGTGCAGCAGGCCCGCAAGGCTGCCGAGTTCTATCGCAAGAAGCAGGAGGAGATGAACCGGCCG
GTGAATCCGAGAGAGCCCCTGAAGCGGACGGCCGACAACAACTGGGTGCACGTCACGTGCGCCGTCTGGACGCCC
GAGGTCAAGTTCGGCAACGCAAAGGCGCTGGAGCCGTCGGAGGGGATCCCGTCGATCCCGAGGTCGAGATACGAC
GAGACGTGCCAGGCTTGCAGCCAGAAGGGCGGCGCGTGCATCTTTTGTCATCACTGCCGCGTTCCGTATCACGTC
GAGTGTGCGCGTCAACAGGGTCACCTGCTCGGGTTCGACATTACGCCGGTCAAGAGCTCGCGGCGCGACCAGTTC
AACATGGTGACGGTCAAGGGAGAGAGCGGCACCATGTCAGCCGTCATGTGGTGCAAAGACCACGTGCCGACCAAG
ACGATGGCGCACCGGATGGACGAGACGGCGGGCGGTTCCGGCCTGAACGCGCTGCAGCTCTACGTGCAGAACTAC
AAGCAGGCGGACCTGACGCTGACTGGCACCGTCCGCAAGGCCAATCTGATGATGAACGCGGCCAAGACGTCGTCG
GCGCCCCCCGTCCAGGTGCCGCGGCGGACGTCGGCCAGCGGAGGGCCTCCCGGGACCGTCAACGGGCGGGCGCGC
AGCAACGAGGCGGCCGAAGCGGCATCAAACAGCCCGCAGCAGGCGGGAGAGAAGGTGTGCATCACGTGTGGCGTC
GACGTGACGCCCAAGTGGTGGCCCATCGACGACTCTCTCGGCCGGCGGCTCACCAACGGACACCATGGCGCTATC
GGCTCCGAGGCGCAGAAGTTTGTCGAGCAGCGGCGATTCCAGTGTCACAAGTGCCGCAAGGCCGCCTGCCCTCCG
ATGCCGTACTCGTCGCCCCCACGTTATCGCGAGGCGAGCAGTAGCAACGGCGGCCAGGGAGCCGGAGTCTCGCCC
CCCGTCGACTATCGTCACGAGCTTCACGCCTTGTTGCACCATCCGGCCTCTCACGCCCCCATGACCGTCGTGGCA
CAACCGCACCACGGACCGACCCATGTCATGGGACCGAGGCCGACGACGGCTGTTTCGCTGCCGTACGTGGCCGCG
CCGCCTTCCCGGCACGGACACTACAATGATTGGAGCCACCAGCAGCCGCCGGGGCCAAGGCACGGGTCGCCGGCG
CGCCACCTCAACGGGGGGCCGCCGCCGCTGCATGGCGGACCTCCTTCCGGTCCTCCCGGCCCGCCCGGTCCGCCA
CCTCCACCGGCCATGTCGAGCCTCTCATCGCTCCGACCGCCGGCCATGTCGGGGCCGCCTCCACCCATGGCTCAC
CACCACTCGCCCATGTACGGCAGCGGCATGCCCGTGTCTCCCCGACGGATGAGCGGGCCCACGCACCCGGCAGCA
TACGTTCCTCCGTACCACGGGCCGGCTGCTCACGGCGCGTCGCCGAGGCTGAGCAACGGAGTGCCGCCGCCCCCG
CGAACGGAGACGTTTTCGCACGGGCTGCACCCGCAGCGATCGCCGTATTCGGGGAGTCCGCCGCTGCCTCGGAGC
GGACTACAACCGGGACCTCACGAGAACGGAAGCAAAGTGGAGAGCTCGCAGGCAAACAAGCCGGCCAGCGGGGCC
AGTGCGAGCCCGTCGCTGCGCAATCTGCTGTCGTGA
Gene >Ophcf2|00409
ATGGCACCGCAAAATGTCCGTTTCTCCCACCGCCCGTCCACCCCATGCCGCGCGTTTTTTTTTTTTTTCCTCTCC
TGCCCCCCCCCCCCCCCCCCTCTCCATCCTCCCCCCCCTTCCCTCGCCCCTCCCCTGCTTCGTCTTCGCCCCATC
TCCCTGCTCTATCACCAGGGCCGCTCGTGTCGTCATGACTGACTCACCACGCGACCAGGCCTCCAAGGAGCCCGA
GCCCGAGTCGACCACGGCCAAGGACGTGTCGTCTTCGCTCCACGGAACTCGGTCGTCGCGCAAAATTGTGCGTCC
CAATTACGCCGAGGACAAGGACATTGACATGGATAATTACGATTTCTACCGCGAAAACAAGCGTCCGGGCCGGCA
TGCGGTTACCGGGCCCGACCGCGGAGGAGGGCGCAGGTCAACCGGGGGCGACTCGAGGATGAGTGAAACCGACGG
CCAGGACGGCGGCGGTTCCTGTGGGAGCGGGACCGGCGGCGGCGCTCCTGTCTCCGCAGCGGCTGTGTCGCACAT
GTCGCGCAAACGCAAGGCGGCCAAGCGGGCTGGAAATGCGGCGCAGACGCCGGCGGCCACGACGGCGCCGTTGCG
AGACACCAACATGATGACCTTTGAGCAGTGCAGCTCGCGCCCGGACCAGGGGCGCATGACGGCTGACGACGGCAC
CGTGCTAGAGCCGAATGGTCAGTCTTCGTCCGGCCCCAGCGCAAACCTTGCTGACGCTGTGCTGCCAGATCACGT
CTACCTGGTGTGCGAGCCGCCCGGAGAGCCCTACTATCTTGGTCGCATCATGGAGTTTCTGCACGCCCAAAACGA
TAGCGCCCGCTGCGTCGAGGCTGTCCGAATCAACTGGTTCTACCGGCCCAAGGACATTGGCCGCAAGCCCCTCGA
CACCCGCCAGGTCTATGCCACGATGCATTCCGACATTAGTCCGCTGACGGCCCTGCGCGGCAAATGCCACATCAA
GCACCGCTGTGAGATTGACAATTTTGACCAGTTCCGCAAGACGCCCGACTCCTTCTGGTTCGACAAGCTGTACGA
CCGCTACATTCAAAAGAACTACGACCTGATCCAGACGGCCAGCATTGTCAACGTCCCGGACAAGGTTAAGAAGAT
GCTCGATGAGCGCTGGAAGTTTGTCTTGGTGGAGCAGGGCCGTGGGAAGGAGCTCACGAGCGCCGTTAAGCTCTG
CAAGAGGTGCAGCGGCTACTGTGCGAGGTACGTTTTCTCGACAGCCCTCTCACTCACACACTCTCTCTCACCTGT
CCTCACCTGTCCTCACCTGTCCTCACCTGCTCCCACCTACTCTCACTTACACTCATCCATCCTCATCTTCTCTCA
TCGAAAATCTCACCCCCTCTCATCTTCCTTTCCTCTGTGTCATTTCCTTCCCTCGCCAACTGTACCCAACCGTAC
CCGATGCATTCCCCTTCACATGTTCACGCACCCCCCCCCCTCCCTTACTCGTGTTACACGAGCAATCTGCGAGGG
GTCGATTGTGTGTCAGAGAGAGACATGAAGACTGGCTAGGGCGAGAGGGAACAACAAGACGACAATGGCACATCA
CCTCTCACACTCGCACACATGCACAAACCTCTGCCATTGTTGCCCAACCAAACCGTCACTAACATGTGTGCTTCC
CCAGCAACGATTCGGTCGATTGTGCCGTCTGCCACAACACCTATCACATGAACTGCGTCAGGCCTCCCCTGTTAA
AAAAGCCCTCACGAGGCTTCGCCTGGTCCTGCGCTGCCTGCAGCAGAGCTCAGGAACGCAAGCTCGAGGCTCGCG
ACACGCCCAACGGTGCCGAATCTGGCGCCCCGGCCGAGGACGAAGAGTTCCCCGACGACGAGGACGACGAGGGCC
AGGGCATCGCCACCGACCGCACCACGCCTGCCGAAGACGCACCCCATCACCAGGGCACCCCCGAGCAAGTCTACC
GCGCCAGCCTGTGGCCTTGGCGCTACCTGGGCATGCATTGCAAGCCCGAAGACGCCCTCGACTACGACGACCGCA
TCTATCCCCGTGCCAGCACCCGCATCGGTCCCCGCCATCAGGCCAACGTCGGCCCCTGGCCGGGCCGTCCGGTGC
AGTATGTGAAGCCTATCGAGACAAAGAAGGGCTCCAAGGGTCAAAAGATGAACAAGGAGGCTCAGGACGCGGAAA
AGGCCGCCAAGGGCAAGCGGCCCAAATGGGTCCAGGACCAGCCTCCCGGTTACGTCGCCCGCGGAGAGGACTATG
ATGACGGCGACTCCAGGGCCACGGCGACGCTCCTATGGAAGCCTCCTCCGCCCGACAGCTCGATTTCGGTCAAGG
CAATGGAGGAATACGACGACGCGACGCAGGCCATGGCCAAGAAGCTCGGCCTGCCACCCCGTTCGACGAACCTCC
GAGACGCGGCAGTGGAGACGCTGTTCCGTCACGACTACGACGTTTCCGATGCTCTCAAGGCCGTTCCGGAGATGC
AGCGGGAGGCCTTCAAAGAGCCGAACCCAAGCGCGACGGAGCACAAGAAGTTCGAAGAGGCCGTATCCAAGTATG
GGTCCGAGCTGCACCAGGTCAAGAAGCACGTCAAGACCATGACGCACGGCGCCGTCGTTCGCTACTACTATACCT
GGAAGAAGACGGATCGTGGGCAGCAGCTCTGGGGCAGCTTCTCTGGACGCAAGGGCAAGAAGCAGGCCAAGAGGG
CCGACGCAGCCGCCAACAAGTTCGCCGACGATGTGGCGGACAACGACGACGACTCGGCCTTTGACACGGGTAAGG
CGGCCGAGAAGAAGCGCAGTTTCGTATGCCAGTTCTGCTCCACGACGACGTCTCGTCAGTGGCGGAGGGCGCCTA
ACATAGCGCCGGGCGTCCCCAGCGATCACGGAGCCCGATCCGGCGGCAAGGACAAGAGCGGCGGGCAGTGCGTCG
TGGCTCTCTGCCGGAGGTGCGCCGAGCTGTGGCGGCGCTACGGCGTCCGGTTCGAGGAAATGGACGAGGGCGGCA
AGAAGGCGGCTCAGTCGGGTGGCAGAGCCTCGAAGCGTAAGCAGGACGAAGAGCTCCTCAAGCAGCAGCAAGCCG
CCCAGGAGGTGAGCCTGACGACTCCGGACCGCGACAACACGCCCCAGAGCGTTCCCGCGCCGGCCGTCAGCCAGG
AACCGCCCCGGAAGAAGCTCAAGGGAGCCCCGTCGGACAGGGAGCCGGATCAGGCATGTTCAGACGGAGGTGGCA
GCGGATCGACGCCCAGCCTTCCCAAGAAGAAGGAAAAGGCGGCGGATGCGACGCCGGTGCCGGAGATGCCGAAGC
CGCGAACGCTGCCGTGCGCCATCTGCCATCAGCTGGAGCCCCAGGGAGACCAGCATCTGTCTTGTCGAGAGTGCC
GGCTGACGGTGCACCGTAACTGCTACGGCATCATGGACAATCGAATTCAGGGGAAATGGATCTGCGACATGTGCT
CCAACGACAAGAGCCCGCAGGTTTCCATCGTGAGTCGTTGGCAAGCTGGTTTTCTGGGTTGGCGGCTAACCGGAG
CGGCAGCAATACAAATGCGTCCTCTGTCCCGTCGAGCACACTGAATGGGACTTTGTCGAGCAGCCCAAGCTCACT
CACCACAAGAAGAAGATGTCGGAAAAGGATCGAGGGCGGGAGAAGATGGAGGTGCAGCAGGCCCGCAAGGCTGCC
GAGTTCTATCGCAAGAAGCAGGAGGAGATGAACCGGCCGGTGAATCCGAGAGAGCCCCTGAAGCGGACGGCCGAC
AACAACTGGGTGCACGTCACGTGCGCCGTCTGGACGCCCGAGGTCAAGTTCGGCAACGCAAAGGCGCTGGAGCCG
TCGGAGGGGATCCCGTCGATCCCGAGGTCGAGATACGACGAGACGTGCCAGGCTTGCAGCCAGAAGGGCGGCGCG
TGCATCTTTTGTCATCACTGCCGCGTTCCGTGTATGTCTTGATGTCATGTTTTGTCGTGACGGGGGCTGACGGGG
CGGGACAGATCACGTCGAGTGTGCGCGTCAACAGGGTCACCTGCTCGGGTTCGACATTACGCCGGTCAAGAGCTC
GCGGCGCGACCAGTTCAACATGGTGACGGTCAAGGGAGAGAGCGGCACCATGTCAGCCGTCATGTGGTGCAAAGA
CCACGTGCCGACCAAGACGATGGCGCACCGGATGGACGAGACGGCGGGCGGTTCCGGCCTGAACGCGCTGCAGCT
CTACGTGCAGAACTACAAGCAGGCGGACCTGACGCTGACTGGCACCGTCCGCAAGGCCAATCTGATGATGAACGC
GGCCAAGACGTCGTCGGCGCCCCCCGTCCAGGTGCCGCGGCGGACGTCGGCCAGCGGAGGGCCTCCCGGGACCGT
CAACGGGCGGGCGCGCAGCAACGAGGCGGCCGAAGCGGCATCAAACAGCCCGCAGCAGGCGGGAGAGAAGGTGTG
CATCACGTGTGGCGTCGACGTGACGCCCAAGTGGTGGCCCATCGACGACTCTCTCGGCCGGCGGCTCACCAACGG
ACACCATGGCGCTATCGGCTCCGAGGCGCAGAAGTTTGTCGAGCAGCGGCGATTCCAGTGTCACAAGTGCCGCAA
GGCCGCCTGCCCTCCGATGCCGTACTCGTCGCCCCCACGTTATCGCGAGGCGAGCAGTAGCAACGGCGGCCAGGG
AGCCGGAGTCTCGCCCCCCGTCGACTATCGTCACGAGCTTCACGCCTTGTTGCACCATCCGGCCTCTCACGGTCC
GCCGTCTCTGCCTCCGGCTCCGACGCTGGCTCCTCCCCTCCGACGGTGCCTCCCAACGGCGGCCCCCTCCAGCCC
CCATGACCGTCGTGGCACAACCGCACCACGGACCGACCCATGTCATGGGACCGAGGCCGACGACGGCTGTTTCGC
TGCCGTACGTGGCCGCGCCGCCTTCCCGGCACGGACACTACAATGATTGGAGCCACCAGCAGCCGCCGGGGCCAA
GGCACGGGTCGCCGGCGCGCCACCTCAACGGGGGGCCGCCGCCGCTGCATGGCGGACCTCCTTCCGGTCCTCCCG
GCCCGCCCGGTCCGCCACCTCCACCGGCCATGTCGAGCCTCTCATCGCTCCGACCGCCGGCCATGTCGGGGCCGC
CTCCACCCATGGCTCACCACCACTCGCCCATGTACGGCAGCGGCATGCCCGTGTCTCCCCGACGGATGAGCGGGC
CCACGCACCCGGCAGCATACGTTCCTCCGTACCACGGGCCGGCTGCTCACGGCGCGTCGCCGAGGCTGAGCAACG
GAGTGCCGCCGCCCCCGCGAACGGAGACGTTTTCGCACGGGCTGCACCCGCAGCGATCGCCGTATTCGGGGAGTC
CGCCGCTGCCTCGGAGCGGACTACAACCGGGACCTCACGAGAACGGAAGCAAAGTGGAGAGCTCGCAGGCAAACA
AGCCGGCCAGCGGGGCCAGTGCGAGCCCGTCGCTGCGCAATCTGCTGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail