Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00407
Gene name
Locationscaffold_01:1704368..1705784
Strand+
Gene length (bp)1416
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 3.6E-10 79 231
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.3E-09 99 215

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6144 0.3379 0.2536 0.0832 0.2061 0.0217 0.2956 0.2479 0.155 0.0296

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3913
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6082
Ophiocordyceps australis map64 (Brazil) OphauB2|7664
Ophiocordyceps camponoti-floridani Ophcf2|00407 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5340
Ophiocordyceps kimflemingae Ophio5|6351
Ophiocordyceps subramaniannii Hirsu2|7793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00407
MEIPTANLLSSTSHAVPGQLLVTELFFQVPLDYADESAGTIILFARRATKRERPVFPPDPSSSSDDDDEKDGPSP
KPYMVYLEGGPGFGNREPQDHPLTRAAIARGYQMLYIDHRGVGLSTPVSADMLARLGSADAQARYLRLMRQDNTV
RDCEAVRQYLTQGWSAAKAPWSIFGQSYGGFVALSYLSMYPQGLREVFLTGGLAPVGQPIERVYEATFARTAHRN
RQYFAKFPEDTQVLRRIVDFIREQGGAVPLPAGGILTVPRLMTLGIAFGGHGGFDGVHSILLHLVTSLDQFGFFT
RAALQPLETFTSFDTNVIYAILHEAIYCDGPGKASDWAAYRVGKALKPFDWLNPGRDDVDSWYLAGEMIFPFHFE
TYPELISLRPVAEELAAATDWPRLYDEQQLRKNTVPVYAMSYIDDMYVDNDLARETAKLVKGTKVAETNLMYHSA
LRAKSEEVLQALFGLRDDVLD*
Coding >Ophcf2|00407
ATGGAGATCCCAACGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGCCAGCTGCTCGTTACCGAACTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATTCTCTTCGCCCGCCGCGCCACAAAG
CGTGAACGACCCGTCTTCCCCCCCGATCCGTCTTCGTCCTCGGATGACGACGATGAAAAGGATGGGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGACCGGGGTTCGGGAATCGCGAACCTCAGGATCATCCTCTTACTCGC
GCCGCCATCGCCCGAGGCTACCAGATGCTCTACATTGATCATCGCGGCGTCGGCCTCAGCACCCCCGTTTCGGCT
GATATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAAGCTCGCTACCTGCGCCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCAATATCTCACTCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGCTTCGTTGCTCTGTCCTACCTATCCATGTACCCGCAAGGTCTTCGTGAGGTCTTCCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCAATCGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGTGTTGCGTCGCATTGTCGACTTCATCCGCGAACAAGGA
GGAGCCGTGCCTCTTCCGGCCGGTGGCATTTTGACGGTACCCCGTCTGATGACGCTCGGCATCGCATTTGGAGGC
CACGGCGGCTTCGACGGAGTTCACTCTATACTCCTTCACCTCGTGACATCCCTCGACCAGTTTGGCTTCTTCACC
CGCGCCGCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGATACCAACGTCATCTATGCCATTCTGCACGAAGCC
ATCTACTGTGACGGTCCTGGAAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAGCCCTCAAACCCTTTGAC
TGGCTCAACCCGGGCCGTGACGACGTCGACTCCTGGTACCTGGCTGGCGAGATGATATTTCCTTTCCACTTCGAG
ACGTACCCGGAGCTCATCTCTTTGCGGCCCGTGGCAGAGGAGCTGGCCGCCGCCACCGACTGGCCACGTCTGTAC
GACGAGCAGCAGCTGCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTATATCGACGACATGTACGTCGACAAC
GACCTCGCCAGGGAGACGGCAAAGCTCGTCAAGGGAACAAAGGTGGCGGAGACGAACCTCATGTACCACTCTGCT
CTGCGGGCCAAATCGGAGGAGGTACTGCAGGCCCTGTTCGGCCTGAGAGATGACGTCCTAGACTGA
Transcript >Ophcf2|00407
ATGGAGATCCCAACGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGCCAGCTGCTCGTTACCGAACTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATTCTCTTCGCCCGCCGCGCCACAAAG
CGTGAACGACCCGTCTTCCCCCCCGATCCGTCTTCGTCCTCGGATGACGACGATGAAAAGGATGGGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGACCGGGGTTCGGGAATCGCGAACCTCAGGATCATCCTCTTACTCGC
GCCGCCATCGCCCGAGGCTACCAGATGCTCTACATTGATCATCGCGGCGTCGGCCTCAGCACCCCCGTTTCGGCT
GATATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAAGCTCGCTACCTGCGCCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCAATATCTCACTCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGCTTCGTTGCTCTGTCCTACCTATCCATGTACCCGCAAGGTCTTCGTGAGGTCTTCCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCAATCGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGTGTTGCGTCGCATTGTCGACTTCATCCGCGAACAAGGA
GGAGCCGTGCCTCTTCCGGCCGGTGGCATTTTGACGGTACCCCGTCTGATGACGCTCGGCATCGCATTTGGAGGC
CACGGCGGCTTCGACGGAGTTCACTCTATACTCCTTCACCTCGTGACATCCCTCGACCAGTTTGGCTTCTTCACC
CGCGCCGCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGATACCAACGTCATCTATGCCATTCTGCACGAAGCC
ATCTACTGTGACGGTCCTGGAAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAGCCCTCAAACCCTTTGAC
TGGCTCAACCCGGGCCGTGACGACGTCGACTCCTGGTACCTGGCTGGCGAGATGATATTTCCTTTCCACTTCGAG
ACGTACCCGGAGCTCATCTCTTTGCGGCCCGTGGCAGAGGAGCTGGCCGCCGCCACCGACTGGCCACGTCTGTAC
GACGAGCAGCAGCTGCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTATATCGACGACATGTACGTCGACAAC
GACCTCGCCAGGGAGACGGCAAAGCTCGTCAAGGGAACAAAGGTGGCGGAGACGAACCTCATGTACCACTCTGCT
CTGCGGGCCAAATCGGAGGAGGTACTGCAGGCCCTGTTCGGCCTGAGAGATGACGTCCTAGACTGA
Gene >Ophcf2|00407
ATGGAGATCCCAACGGCCAACCTGCTCAGCAGCACCAGCCACGCCGTCCCCGGCCAGCTGCTCGTTACCGAACTC
TTCTTCCAGGTGCCTCTCGACTACGCCGACGAGTCAGCCGGCACAATCATTCTCTTCGCCCGCCGCGCCACAAAG
CGTGAACGACCCGTCTTCCCCCCCGATCCGTCTTCGTCCTCGGATGACGACGATGAAAAGGATGGGCCCTCGCCG
AAGCCGTACATGGTCTACCTCGAGGGCGGACCGGGGTTCGGGAATCGCGAACCTCAGGATCATCCTCTTACTCGC
GCCGCCATCGCCCGAGGCTACCAGATGCTCTACATTGATCATCGCGGCGTCGGCCTCAGCACCCCCGTTTCGGCT
GATATGCTCGCCCGTCTCGGCTCTGCAGACGCCCAAGCTCGCTACCTGCGCCTCATGCGTCAGGATAACACCGTT
CGCGACTGTGAGGCCGTCCGTCAATATCTCACTCAAGGCTGGTCCGCTGCCAAGGCTCCCTGGTCCATCTTTGGA
CAGTCTTACGGCGGCTTCGTTGCTCTGTCCTACCTATCCATGTACCCGCAAGGTCTTCGTGAGGTCTTCCTCACC
GGTGGCCTCGCCCCCGTCGGCCAGCCAATCGAGCGCGTCTACGAGGCAACTTTTGCCAGGACGGCTCACCGCAAC
CGCCAGTATTTCGCAAAGTTTCCCGAGGACACCCAAGTGTTGCGTCGCATTGTCGACTTCATCCGCGAACAAGGA
GGAGCCGTGCCTCTTCCGGCCGGTGGCATTTTGACGGTACCCCGTCTGATGACGCTCGGCATCGCATTTGGAGGC
CACGGCGGCTTCGACGGAGTTCACTCTATACTCCTTCACCTCGTGACATCCCTCGACCAGTTTGGCTTCTTCACC
CGCGCCGCCCTCCAGCCCCTCGAGACCTTTACCTCGTTCGATACCAACGTCATCTATGCCATTCTGCACGAAGCC
ATCTACTGTGACGGTCCTGGAAAGGCCTCTGACTGGGCCGCCTATCGCGTAGGAAAAGCCCTCAAACCCTTTGAC
TGGCTCAACCCGGGCCGTGACGACGTCGACTCCTGGTACCTGGCTGGCGAGATGATATTTCCTTTCCACTTCGAG
ACGTACCCGGAGCTCATCTCTTTGCGGCCCGTGGCAGAGGAGCTGGCCGCCGCCACCGACTGGCCACGTCTGTAC
GACGAGCAGCAGCTGCGCAAAAACACCGTTCCCGTCTACGCCATGTCGTATATCGACGACATGTACGTCGACAAC
GACCTCGCCAGGGAGACGGCAAAGCTCGTCAAGGGAACAAAGGTGGCGGAGACGAACCTCATGTACCACTCTGCT
CTGCGGGCCAAATCGGAGGAGGTACTGCAGGCCCTGTTCGGCCTGAGAGATGACGTCCTAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail