Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00405
Gene name
Locationscaffold_01:1697698..1701874
Strand+
Gene length (bp)4176
Transcript length (bp)2970
Coding sequence length (bp)2970
Protein length (aa) 990

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09335 SNARE_assoc SNARE associated Golgi protein 1.8E-14 743 857
PF08590 DUF1771 Domain of unknown function (DUF1771) 1.2E-14 521 584
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 6.9E-03 285 304
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.1E-02 310 329
PF01713 Smr Smr domain 1.3E-06 596 651

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 722 744 22
2 751 773 22
3 875 897 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 58.07 32.30 83.85
Alive In ants, during behavior modification 93.96 47.79 140.13
Dead In ants, recently dead 73.33 39.39 107.28

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.014140 yes
Alive Dead 0.181812 no
Dead Fungus 0.261854 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00405
MVSDENYELCLHILQDASLEDEDKTDRIEELLKKETNLSGPSLENAVLDAMWRYREANGASTSPPSLRQSILRRP
SPASWRGSPTPLNGSPRLGVSPLAPPGFVSTFNRTKSSTASPFSSPRASPRLALATPAIPHSPNLNAYEFASDST
PAAEIMGDYQTENVEWLVNDDAASVTSSVGTSSGLNAAAPEFSSMTSQQADMSPYDMLRSILGKTRTDLEIEAAL
DMHGYDLSATITSIMESQAREGGLISVPPIDEPKGVLIGKSISADGRPSTPAGQQKSTVICKFYMSTGQCLRADC
RFSHDLSNHLCKYWVMGSCLAGETCIFSHDPSTLLSKVTLDENGNEAANNQESPSLQDVDSFPCLQDDRLGQRSG
DGGALAANLATPMGPRHLFGAEAPRLRSRPVSRQQAKETMTSAPAPDDNEAFPSLGSALTRQGKKHHGKRGGHGH
SHKENLAPSSLADIVRRTPSPAPGPARPELKKAGQNGSARNGGENSAAARAIPSPKHIPWLETGERANKAYLKAR
QEAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHREAARELYEQRNKGGMNNGSEIYVDLHG
LHPDEAVEYLERTLMENSREARPVYAITGTGHHSKNGKDKMGRAIRTYLGEWRYAYREFSVPGDRNSMGGILGVD
ARSCDKSRGKVTAAQDGSKVDILTYLSHYFFFTWLAPLARTYKGHPLALTLVFLAIFVSAFPPLVGYSTAATVAG
FVAGFPGGWPLAATAAVAGSLAAFAASRSVLGSCVERWVGKDRRFVALAQVLRRDGLLCLAGIRLCPLPFSLSNG
FLATVPSVSPWSFAVATAISSPKLLVHVFIGSRLALLADEGDTMSASDKAINYLSMAASALIGLVVGLMVYRRTM
ARAAQLARQEIHHAHSRRHLSSSAAVDAEAGYHDVDAPLLDPDDAAAVMMDDNLSSWTVDDGEEEDGHGPSKAAM
SGGGNGHSHLGFSA*
Coding >Ophcf2|00405
ATGGTTTCTGACGAGAACTACGAGCTGTGCCTGCACATCCTGCAGGACGCCTCGCTGGAAGACGAGGATAAGACG
GACAGGATCGAGGAGCTTCTCAAGAAAGAGACGAACCTGTCTGGCCCCTCGCTGGAAAATGCCGTTCTCGATGCC
ATGTGGAGATATAGAGAGGCGAACGGAGCTTCAACGTCGCCTCCGTCTCTCCGGCAATCTATCCTGCGCCGTCCA
TCTCCGGCATCCTGGCGCGGATCTCCGACGCCCTTGAACGGCTCCCCGCGCCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGTTTCGTGTCCACCTTTAATCGCACCAAGTCGTCGACGGCCTCGCCCTTCTCGTCGCCTCGCGCCTCCCCG
CGCTTAGCCTTGGCTACGCCCGCCATACCGCATAGTCCGAACCTCAACGCTTACGAGTTCGCAAGCGACTCCACG
CCCGCCGCCGAGATTATGGGCGACTATCAGACGGAGAATGTTGAATGGCTCGTCAACGATGATGCTGCCAGCGTC
ACGTCATCCGTCGGCACATCGAGCGGGCTCAACGCCGCCGCACCCGAGTTCTCCTCCATGACCTCGCAGCAGGCC
GACATGTCGCCTTACGACATGCTCCGCTCCATTCTCGGCAAAACCCGGACCGACCTTGAGATAGAGGCCGCCCTC
GACATGCATGGCTACGACCTGAGCGCCACCATCACCTCTATAATGGAGAGTCAGGCCCGCGAAGGAGGGCTGATT
TCCGTGCCCCCTATCGATGAGCCCAAGGGCGTGCTAATAGGAAAGTCGATTTCCGCCGACGGACGTCCGTCAACT
CCCGCAGGCCAGCAAAAGTCTACGGTCATCTGCAAATTTTACATGTCTACTGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAATCATCTCTGCAAGTACTGGGTTATGGGGAGTTGCCTCGCCGGCGAGACCTGC
ATCTTCTCTCACGATCCGTCTACGCTTCTCAGCAAAGTGACACTCGATGAAAACGGAAATGAGGCTGCCAATAAC
CAGGAAAGCCCTTCATTGCAAGATGTTGACTCGTTTCCTTGCCTTCAAGACGACAGGTTGGGCCAAAGAAGCGGC
GATGGTGGCGCACTTGCGGCGAACTTGGCGACCCCGATGGGACCACGTCATCTCTTTGGTGCGGAAGCTCCGCGG
TTGCGATCGCGACCCGTCAGTCGACAGCAAGCCAAAGAGACGATGACGTCGGCTCCGGCACCGGACGATAATGAG
GCTTTTCCGTCGCTAGGTTCGGCCTTGACGAGGCAAGGCAAGAAGCACCACGGAAAGCGTGGCGGCCACGGCCAT
TCTCATAAAGAGAACCTCGCGCCGAGCTCGCTGGCAGACATTGTCAGGAGAACGCCTTCGCCGGCCCCCGGGCCA
GCGAGGCCGGAGCTGAAGAAGGCCGGACAGAACGGCAGCGCGCGCAATGGTGGTGAGAACAGCGCAGCGGCACGG
GCAATCCCCAGCCCCAAGCACATTCCATGGCTGGAAACTGGCGAACGGGCCAACAAGGCGTATCTGAAGGCTCGG
CAGGAAGCCATTAAGCATGGCGGGCTTCGCAATAAGTTCCTGCAAAGCGCGGCGCAGGCGTGGAACCGCAACGAC
GCGAGAGCAGCCAAGGCACTCAGCCTTCGCGGGCAGAGCGAGAACGACCTCATGCGAAAGGCGCATCGAGAGGCG
GCGCGCGAGCTGTACGAGCAACGGAACAAGGGAGGCATGAACAACGGATCGGAGATTTACGTCGACCTTCATGGG
CTCCATCCGGACGAAGCGGTCGAATACCTCGAAAGGACGCTGATGGAGAATAGCAGGGAGGCGAGGCCAGTGTAC
GCCATCACTGGCACGGGGCACCACAGCAAGAACGGCAAGGATAAGATGGGCAGAGCTATCCGCACTTACCTCGGC
GAGTGGCGCTACGCGTATCGCGAGTTCTCGGTGCCCGGCGACCGCAACAGCATGGGCGGGATCTTGGGCGTCGAC
GCGCGCAGCTGTGACAAGTCGCGGGGGAAGGTGACGGCCGCGCAAGATGGATCCAAGGTGGATATTCTCACCTAC
CTCTCCCACTACTTCTTCTTCACCTGGCTCGCGCCCCTGGCCCGCACCTACAAGGGCCACCCCCTAGCCCTGACG
CTCGTCTTCCTCGCCATCTTCGTCTCCGCCTTCCCGCCGCTGGTGGGATACTCGACGGCCGCCACCGTCGCCGGC
TTCGTCGCCGGCTTCCCCGGCGGTTGGCCTCTTGCTGCCACGGCGGCGGTGGCCGGCAGCTTGGCGGCTTTTGCC
GCGAGCCGTTCTGTGTTGGGGAGCTGTGTTGAGAGGTGGGTTGGCAAGGATAGGCGCTTCGTTGCTTTGGCGCAG
GTTTTGAGGAGGGATGGCTTGCTTTGCTTGGCGGGCATTCGCCTCTGTCCTCTGCCGTTTAGTTTGAGTAATGGG
TTTTTGGCAACGGTTCCCAGCGTTTCTCCATGGTCTTTTGCTGTTGCCACTGCTATATCCAGCCCCAAGCTTCTA
GTCCACGTCTTCATCGGAAGCCGTCTCGCCCTCCTCGCCGACGAGGGAGACACAATGTCCGCCTCGGACAAGGCA
ATCAACTACCTGAGCATGGCAGCCAGCGCCCTGATAGGCCTGGTAGTCGGTCTGATGGTCTACCGCCGCACCATG
GCTCGAGCCGCTCAACTCGCTCGCCAAGAGATTCATCATGCTCATTCGCGTCGTCATCTCTCTTCTTCGGCTGCT
GTTGATGCTGAGGCGGGATATCACGATGTGGATGCTCCGCTTCTCGATCCGGATGATGCTGCTGCTGTCATGATG
GATGATAATCTGTCGTCGTGGACGGTTGATGACGGTGAGGAGGAGGATGGTCATGGTCCTTCCAAGGCGGCCATG
TCGGGGGGAGGCAATGGGCATTCGCATCTTGGTTTCTCCGCCTGA
Transcript >Ophcf2|00405
ATGGTTTCTGACGAGAACTACGAGCTGTGCCTGCACATCCTGCAGGACGCCTCGCTGGAAGACGAGGATAAGACG
GACAGGATCGAGGAGCTTCTCAAGAAAGAGACGAACCTGTCTGGCCCCTCGCTGGAAAATGCCGTTCTCGATGCC
ATGTGGAGATATAGAGAGGCGAACGGAGCTTCAACGTCGCCTCCGTCTCTCCGGCAATCTATCCTGCGCCGTCCA
TCTCCGGCATCCTGGCGCGGATCTCCGACGCCCTTGAACGGCTCCCCGCGCCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGTTTCGTGTCCACCTTTAATCGCACCAAGTCGTCGACGGCCTCGCCCTTCTCGTCGCCTCGCGCCTCCCCG
CGCTTAGCCTTGGCTACGCCCGCCATACCGCATAGTCCGAACCTCAACGCTTACGAGTTCGCAAGCGACTCCACG
CCCGCCGCCGAGATTATGGGCGACTATCAGACGGAGAATGTTGAATGGCTCGTCAACGATGATGCTGCCAGCGTC
ACGTCATCCGTCGGCACATCGAGCGGGCTCAACGCCGCCGCACCCGAGTTCTCCTCCATGACCTCGCAGCAGGCC
GACATGTCGCCTTACGACATGCTCCGCTCCATTCTCGGCAAAACCCGGACCGACCTTGAGATAGAGGCCGCCCTC
GACATGCATGGCTACGACCTGAGCGCCACCATCACCTCTATAATGGAGAGTCAGGCCCGCGAAGGAGGGCTGATT
TCCGTGCCCCCTATCGATGAGCCCAAGGGCGTGCTAATAGGAAAGTCGATTTCCGCCGACGGACGTCCGTCAACT
CCCGCAGGCCAGCAAAAGTCTACGGTCATCTGCAAATTTTACATGTCTACTGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAATCATCTCTGCAAGTACTGGGTTATGGGGAGTTGCCTCGCCGGCGAGACCTGC
ATCTTCTCTCACGATCCGTCTACGCTTCTCAGCAAAGTGACACTCGATGAAAACGGAAATGAGGCTGCCAATAAC
CAGGAAAGCCCTTCATTGCAAGATGTTGACTCGTTTCCTTGCCTTCAAGACGACAGGTTGGGCCAAAGAAGCGGC
GATGGTGGCGCACTTGCGGCGAACTTGGCGACCCCGATGGGACCACGTCATCTCTTTGGTGCGGAAGCTCCGCGG
TTGCGATCGCGACCCGTCAGTCGACAGCAAGCCAAAGAGACGATGACGTCGGCTCCGGCACCGGACGATAATGAG
GCTTTTCCGTCGCTAGGTTCGGCCTTGACGAGGCAAGGCAAGAAGCACCACGGAAAGCGTGGCGGCCACGGCCAT
TCTCATAAAGAGAACCTCGCGCCGAGCTCGCTGGCAGACATTGTCAGGAGAACGCCTTCGCCGGCCCCCGGGCCA
GCGAGGCCGGAGCTGAAGAAGGCCGGACAGAACGGCAGCGCGCGCAATGGTGGTGAGAACAGCGCAGCGGCACGG
GCAATCCCCAGCCCCAAGCACATTCCATGGCTGGAAACTGGCGAACGGGCCAACAAGGCGTATCTGAAGGCTCGG
CAGGAAGCCATTAAGCATGGCGGGCTTCGCAATAAGTTCCTGCAAAGCGCGGCGCAGGCGTGGAACCGCAACGAC
GCGAGAGCAGCCAAGGCACTCAGCCTTCGCGGGCAGAGCGAGAACGACCTCATGCGAAAGGCGCATCGAGAGGCG
GCGCGCGAGCTGTACGAGCAACGGAACAAGGGAGGCATGAACAACGGATCGGAGATTTACGTCGACCTTCATGGG
CTCCATCCGGACGAAGCGGTCGAATACCTCGAAAGGACGCTGATGGAGAATAGCAGGGAGGCGAGGCCAGTGTAC
GCCATCACTGGCACGGGGCACCACAGCAAGAACGGCAAGGATAAGATGGGCAGAGCTATCCGCACTTACCTCGGC
GAGTGGCGCTACGCGTATCGCGAGTTCTCGGTGCCCGGCGACCGCAACAGCATGGGCGGGATCTTGGGCGTCGAC
GCGCGCAGCTGTGACAAGTCGCGGGGGAAGGTGACGGCCGCGCAAGATGGATCCAAGGTGGATATTCTCACCTAC
CTCTCCCACTACTTCTTCTTCACCTGGCTCGCGCCCCTGGCCCGCACCTACAAGGGCCACCCCCTAGCCCTGACG
CTCGTCTTCCTCGCCATCTTCGTCTCCGCCTTCCCGCCGCTGGTGGGATACTCGACGGCCGCCACCGTCGCCGGC
TTCGTCGCCGGCTTCCCCGGCGGTTGGCCTCTTGCTGCCACGGCGGCGGTGGCCGGCAGCTTGGCGGCTTTTGCC
GCGAGCCGTTCTGTGTTGGGGAGCTGTGTTGAGAGGTGGGTTGGCAAGGATAGGCGCTTCGTTGCTTTGGCGCAG
GTTTTGAGGAGGGATGGCTTGCTTTGCTTGGCGGGCATTCGCCTCTGTCCTCTGCCGTTTAGTTTGAGTAATGGG
TTTTTGGCAACGGTTCCCAGCGTTTCTCCATGGTCTTTTGCTGTTGCCACTGCTATATCCAGCCCCAAGCTTCTA
GTCCACGTCTTCATCGGAAGCCGTCTCGCCCTCCTCGCCGACGAGGGAGACACAATGTCCGCCTCGGACAAGGCA
ATCAACTACCTGAGCATGGCAGCCAGCGCCCTGATAGGCCTGGTAGTCGGTCTGATGGTCTACCGCCGCACCATG
GCTCGAGCCGCTCAACTCGCTCGCCAAGAGATTCATCATGCTCATTCGCGTCGTCATCTCTCTTCTTCGGCTGCT
GTTGATGCTGAGGCGGGATATCACGATGTGGATGCTCCGCTTCTCGATCCGGATGATGCTGCTGCTGTCATGATG
GATGATAATCTGTCGTCGTGGACGGTTGATGACGGTGAGGAGGAGGATGGTCATGGTCCTTCCAAGGCGGCCATG
TCGGGGGGAGGCAATGGGCATTCGCATCTTGGTTTCTCCGCCTGA
Gene >Ophcf2|00405
ATGGTTTCTGACGAGAACTACGAGCTGTGCCTGCACATCCTGCAGGACGCCTCGCTGGAAGACGAGGATAAGACG
GACAGGATCGAGGAGCTTCTCAAGAAAGAGACGAACCTGTCTGGCCCCTCGCTGGAAAATGCCGTTCTCGATGCC
ATGTGGAGATATAGAGAGGCGAACGGAGCTTCAACGTCGCCTCCGTCTCTCCGGCAATCTATCCTGCGCCGTCCA
TCTCCGGCATCCTGGCGCGGATCTCCGACGCCCTTGAACGGCTCCCCGCGCCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGTTTCGTGTCCACCTTTAATCGCACCAAGTCGTCGACGGCCTCGCCCTTCTCGTCGCCTCGCGCCTCCCCG
CGCTTAGCCTTGGCTACGCCCGCCATACCGCATAGTCCGAACCTCAACGCTTACGAGTTCGCAAGCGACTCCACG
CCCGCCGCCGAGATTATGGGCGACTATCAGACGGAGAATGTTGAATGGCTCGTCAACGATGATGCTGCCAGCGTC
ACGTCATCCGTCGGCACATCGAGCGGGCTCAACGCCGCCGCACCCGAGTTCTCCTCCATGACCTCGCAGCAGGCC
GACATGTCGCCTTACGACATGCTCCGCTCCATTCTCGGCAAAACCCGGACCGACCTTGAGATAGAGGCCGCCCTC
GACATGCATGGCTACGACCTGAGCGCCACCATCACCTCTATAATGGAGAGTCAGGCCCGCGAAGGAGGGCTGATT
TCCGTGCCCCCTATCGATGAGCCCAAGGGCGTGCTAATAGGAAAGTCGATTTCCGCCGACGGACGTCCGTCAACT
CCCGCAGGCCAGCAAAAGTCTACGGTCATCTGCAAATTTTACATGTCTACTGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATCTGAGCAATCATCTCTGCAAGTGAGTGTCTTCTACATTTTTTTTTCTTATCAACCGCGTC
GTATCCTAAATGTCCGAATATATCTTATGTAAAGTAAATGAGAACCAAGGAATCTCTGCTGACACTTTCTTTCCA
AGGTACTGGGTTATGGGGAGTTGCCTCGCCGGCGAGACCTGCATCTTCTCTCACGATCCGTCTACGCTTCTCAGC
AAAGTGACACTCGATGAAAACGGAAATGAGGCTGCCAATAACCAGGAAAGCCCTTCATTGCAAGATGTTGACTCG
TTTCCTTGCCTTCAAGACGACAGGTTGGGCCAAAGAAGCGGCGATGGTGGCGCACTTGCGGCGAACTTGGCGACC
CCGATGGGACCACGTCATCTCTTTGGTGCGGAAGCTCCGCGGTTGCGATCGCGACCCGTCAGTCGACAGCAAGCC
AAAGAGACGATGACGTCGGCTCCGGCACCGGACGATAATGAGGCTTTTCCGTCGCTAGGTTCGGCCTTGACGAGG
CAAGGCAAGAAGCACCACGGAAAGCGTGGCGGCCACGGCCATTCTCATAAAGAGAACCTCGCGCCGAGCTCGCTG
GCAGACATTGTCAGGAGAACGCCTTCGCCGGCCCCCGGGCCAGCGAGGCCGGAGCTGAAGAAGGCCGGACAGAAC
GGCAGCGCGCGCAATGGTGGTGAGAACAGCGCAGCGGCACGGGCAATCCCCAGCCCCAAGCACATTCCATGGCTG
GAAACTGGCGAACGGGCCAACAAGGCGTATCTGAAGGCTCGGCAGGAAGCCATTAAGCATGGCGGGCTTCGCAAT
AAGTTCCTGCAAAGGTATGCGGATATCGCTGTGTAGCAAAGCGTTGGGAGCGCCAGGCTCGGAGCGCCAGGCTGA
CTGTATACAACAGCGCGGCGCAGGCGTGGAACCGCAACGACGCGAGAGCAGCCAAGGCACTCAGCCTTCGCGGGC
AGAGCGAGAACGACCTCATGCGAAAGGCGCATCGAGAGGCGGCGCGCGAGCTGTACGAGCAACGGAACAAGGGAG
GCATGAACAACGGATCGGAGATTTACGTCGACCTTCATGGGCTCCATCCGGACGAAGCGGTCGAATACCTCGAAA
GGACGCTGATGGAGAATAGCAGGGAGGCGAGGCCAGTGTACGCCATCACTGGCACGGGGCACCACAGCAAGAACG
GCAAGGATAAGATGGGCAGAGCTATCCGCACTTACCTCGGCGAGTGGCGCTACGCGTATCGCGAGTTCTCGGTGC
CCGGCGACCGCAACAGCATGGGCGGGATCTTGGGCGTCGACGCGCGCAGCTGTGACAAGTCGCGGGGGAAGGTGA
CGGCCGCGCAAGATGGATCCAAGGTGGATATTCTCAGTCAGGGCGTGGAGATTGGGGATGGCAAGGTGAGGCTGC
TGGTCCGGGATCCGCCCAAGGGGCCTAGCGGGCGACGATGATGGCTAGACGTCGTCGTCGATCTGTGTCACGTGC
CACGATCAGCTGGGGCTAGAGATAAGATAAGATGGGAGGAGTCGGGATGAGGTAAAGATGACGGAAGCGATGTCG
CCATGTGTTCATGTGATATGCGTAGCACGTGATGCCGCAGAGGCATCCATCGGCACGACCGACACGAGGCATCCC
AAACCAGATGGAAGAAGAGGAAAGAAAAAAAAAGAGGTGGGTGAAGTGAAAGTAGCGTCTTGCAGTGGCAGGCTC
GAGTCGGTCGCCAAAAGACATTCCAGAGCTACCTACCTACATATGTATGTAGTCAGAGGCGACGGCCTCGGCCGA
GCCGCAACATGAATCAGGGCAATTACTAATGTGGCTTCGAGCCCGGGGAGGGCTGAGCCTCAGCCTCGTTTTAGG
AGGCGCAGGGGTTCTGGGGGGAAAGGGGGGGACGACGTTTCCTCTTAATGGAGGGCTGACGGGGGGAGGGGATTC
TTAACCTCGTTGTCTGCGCCCGGCCAAGGATCTTTTCTTGGCTTCTCGGCTTTACATTTCTGATTGTTTGATGGT
GTTTCTGTTGTTGTTGTTGTTGTTGCTGTCGCTGATTGTGTTGCTGTTGCTGTTGCTGTTGCAGTCGCAGTTGCA
GTTGCAGACGCTGCTGTCCTCCATCCTCATCGTCGTCGAGATCCATTCCTCCCACGCAAACTGCTCCCTTCGATG
CCAGACCGCGAGAGAAGCCGACCGGGACGGAGGACCTCCTCCCCTCCCCCCCCCAACCCTACCGACCAAACTCCT
AACCCGAGTACAATCCCTGACCCTCGGCCAAAGACTCTCCCTCTGCGCGCTAACCGTCGTCCTCGTCACCGGCCT
CGCCATATCAGCAGCCTACCTCTCCCACTACTTCTTCTTCACCTGGCTCGCGCCCCTGGCCCGCACCTACAAGGG
CCACCCCCTAGCCCTGACGCTCGTCTTCCTCGCCATCTTCGTCTCCGCCTTCCCGCCGCTGGTGGGATACTCGAC
GGCCGCCACCGTCGCCGGCTTCGTCGCCGGCTTCCCCGGCGGTTGGCCTCTTGCTGCCACGGCGGCGGTGGCCGG
CAGCTTGGCGGCTTTTGCCGCGAGCCGTTCTGTGTTGGGGAGCTGTGTTGAGAGGTGGGTTGGCAAGGATAGGCG
CTTCGTTGCTTTGGCGCAGGTTTTGAGGAGGGATGGCTTGCTTTGCTTGGCGGGCATTCGCCTCTGTCCTCTGCC
GTTTAGTTTGAGTAATGGGTTTTTGGCAACGGTTCCCAGCGTTTCTCCATGGTCTTTTGCTGTTGCCACTGCTAT
ATCCAGGTATTGTCCCTCGTCCCTATCCCTTTTGGCATCATTCTCTCACTGACTCGTCTTCCGCAAAGCCCCAAG
CTTCTAGTCCACGTCTTCATCGGAAGCCGTCTCGCCCTCCTCGCCGACGAGGGAGACACAATGTCCGCCTCGGAC
AAGGCAATCAACTACCTGAGCATGGCAGCCAGCGCCCTGATAGGCCTGGTAGTCGGTCTGATGGTCTACCGCCGC
ACCATGGCTCGAGCCGCTCAACTCGCTCGCCAAGAGATTCATCATGCTCATTCGCGTCGTCATCTCTCTTCTTCG
GCTGCTGTTGATGCTGAGGCGGGATATCACGATGTGGATGCTCCGCTTCTCGATCCGGATGATGCTGCTGCTGTC
ATGATGGATGATAATCTGTCGTCGTGGACGGTTGATGACGGTGAGGAGGAGGATGGTCATGGTCCTTCCAAGGCG
GCCATGTCGGGGGGAGGCAATGGGCATTCGCATCTTGGTTTCTCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail