Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00404
Gene name
Locationscaffold_01:1694814..1696306
Strand+
Gene length (bp)1492
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 3.7E-15 136 349
PF02373 JmjC JmjC domain, hydroxylase 1.2E-09 239 349

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3425 0.9355 0.0499 0.0157 0.1194 0.0344 0.0493 0.0201 0.0366 0.0192

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5365
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6086
Ophiocordyceps australis map64 (Brazil) OphauB2|7660
Ophiocordyceps camponoti-floridani Ophcf2|00404 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3976
Ophiocordyceps kimflemingae Ophio5|6346
Ophiocordyceps subramaniannii Hirsu2|53

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00404
MVMTATLGFASSHDDSIPMHPLRIKPLGNPSPGRDSHFMHALCRSDELWKAIYIGLPKDHSHSLPWRGSWRSTVR
ALPKDRDSNVDCGCVFSDVLHRPFACTNINLSQYVADIPETNLISRFDCLTYEDFAEHWTERPFILTRCIRDWPA
CTFWTLDSLLRDYADVEFRAEAVDWTLRQYWSYMNDNQDESPLYLFDRKFVEKMKIRVGHEAEAAYWRPDCFGPD
LLEVLGMERPAHRWLIAGPKRSGSTFHKDPNGTSAWNAVIQGAKYWIMFPPAACVPGVYVSADSSEVTSPLSIAE
WLLTFHREARRLPGCVEGVCLAGEVLHVPSGWWHLVVNLESGIAVTQNFVPLSPSLKLVSEVLSFLRDKPDQVSG
FPTTVEDPYGLLVDRLREAYPDVLDRALYLSSKRGGNKRKWDTAVEEAGQGFSFGFGVEDDIDVP*
Coding >Ophcf2|00404
ATGGTCATGACGGCGACTCTCGGCTTCGCCTCGTCGCATGATGACTCGATTCCCATGCATCCTCTACGCATCAAG
CCTCTGGGAAACCCCTCTCCCGGACGAGACTCTCATTTTATGCATGCCTTGTGTCGTTCAGACGAGTTGTGGAAG
GCTATTTACATCGGACTACCCAAGGACCACAGCCACTCACTTCCCTGGCGTGGGTCTTGGAGAAGCACCGTCCGA
GCTTTGCCCAAGGACCGCGATTCCAATGTCGACTGCGGGTGTGTCTTCTCCGACGTTCTACACCGACCCTTTGCC
TGCACCAATATAAACCTGTCGCAATATGTCGCCGACATCCCAGAGACCAACCTCATCTCTCGATTCGACTGTCTT
ACGTACGAAGACTTTGCAGAGCACTGGACCGAGCGGCCCTTCATCTTGACAAGATGCATACGGGACTGGCCCGCT
TGCACCTTTTGGACGCTAGATAGCCTCCTTCGAGACTATGCAGACGTCGAGTTTAGAGCTGAGGCCGTCGACTGG
ACGCTACGCCAATATTGGAGCTACATGAACGATAACCAGGACGAGAGTCCCTTGTACCTGTTTGATCGTAAATTT
GTCGAAAAGATGAAGATAAGGGTCGGTCACGAAGCCGAAGCGGCGTATTGGCGGCCAGACTGCTTTGGACCGGAC
CTCTTGGAGGTTCTGGGAATGGAGCGGCCGGCTCATCGTTGGCTGATTGCGGGCCCCAAAAGGAGCGGCTCAACA
TTTCACAAAGACCCCAACGGAACTAGCGCCTGGAACGCGGTGATTCAGGGGGCCAAGTATTGGATCATGTTTCCG
CCCGCGGCGTGTGTACCGGGTGTCTACGTTTCGGCGGACAGCAGCGAGGTGACGAGCCCGCTCAGCATCGCCGAG
TGGCTGCTCACCTTTCACCGCGAGGCTCGCCGGCTGCCCGGGTGTGTCGAGGGGGTTTGTCTCGCCGGTGAGGTT
CTCCATGTGCCCAGCGGCTGGTGGCATTTGGTGGTGAATCTTGAGAGTGGCATCGCCGTGACGCAGAACTTCGTA
CCCCTTTCGCCGAGCCTAAAGCTCGTCTCTGAGGTGCTGTCCTTTCTACGCGACAAGCCGGACCAAGTATCGGGC
TTCCCGACGACGGTCGAAGATCCCTATGGACTCTTGGTCGATAGACTCCGGGAAGCATATCCCGATGTCCTCGAC
AGGGCGCTGTACCTATCGTCGAAAAGAGGTGGAAATAAGCGCAAATGGGACACGGCCGTCGAAGAAGCTGGACAG
GGATTCAGTTTTGGCTTCGGCGTCGAAGACGACATCGACGTGCCTTAG
Transcript >Ophcf2|00404
ATGGTCATGACGGCGACTCTCGGCTTCGCCTCGTCGCATGATGACTCGATTCCCATGCATCCTCTACGCATCAAG
CCTCTGGGAAACCCCTCTCCCGGACGAGACTCTCATTTTATGCATGCCTTGTGTCGTTCAGACGAGTTGTGGAAG
GCTATTTACATCGGACTACCCAAGGACCACAGCCACTCACTTCCCTGGCGTGGGTCTTGGAGAAGCACCGTCCGA
GCTTTGCCCAAGGACCGCGATTCCAATGTCGACTGCGGGTGTGTCTTCTCCGACGTTCTACACCGACCCTTTGCC
TGCACCAATATAAACCTGTCGCAATATGTCGCCGACATCCCAGAGACCAACCTCATCTCTCGATTCGACTGTCTT
ACGTACGAAGACTTTGCAGAGCACTGGACCGAGCGGCCCTTCATCTTGACAAGATGCATACGGGACTGGCCCGCT
TGCACCTTTTGGACGCTAGATAGCCTCCTTCGAGACTATGCAGACGTCGAGTTTAGAGCTGAGGCCGTCGACTGG
ACGCTACGCCAATATTGGAGCTACATGAACGATAACCAGGACGAGAGTCCCTTGTACCTGTTTGATCGTAAATTT
GTCGAAAAGATGAAGATAAGGGTCGGTCACGAAGCCGAAGCGGCGTATTGGCGGCCAGACTGCTTTGGACCGGAC
CTCTTGGAGGTTCTGGGAATGGAGCGGCCGGCTCATCGTTGGCTGATTGCGGGCCCCAAAAGGAGCGGCTCAACA
TTTCACAAAGACCCCAACGGAACTAGCGCCTGGAACGCGGTGATTCAGGGGGCCAAGTATTGGATCATGTTTCCG
CCCGCGGCGTGTGTACCGGGTGTCTACGTTTCGGCGGACAGCAGCGAGGTGACGAGCCCGCTCAGCATCGCCGAG
TGGCTGCTCACCTTTCACCGCGAGGCTCGCCGGCTGCCCGGGTGTGTCGAGGGGGTTTGTCTCGCCGGTGAGGTT
CTCCATGTGCCCAGCGGCTGGTGGCATTTGGTGGTGAATCTTGAGAGTGGCATCGCCGTGACGCAGAACTTCGTA
CCCCTTTCGCCGAGCCTAAAGCTCGTCTCTGAGGTGCTGTCCTTTCTACGCGACAAGCCGGACCAAGTATCGGGC
TTCCCGACGACGGTCGAAGATCCCTATGGACTCTTGGTCGATAGACTCCGGGAAGCATATCCCGATGTCCTCGAC
AGGGCGCTGTACCTATCGTCGAAAAGAGGTGGAAATAAGCGCAAATGGGACACGGCCGTCGAAGAAGCTGGACAG
GGATTCAGTTTTGGCTTCGGCGTCGAAGACGACATCGACGTGCCTTAG
Gene >Ophcf2|00404
ATGGTCATGACGGCGACTCTCGGCTTCGCCTCGTCGCATGATGACTCGATTCCCATGCATCCTCTACGCATCAAG
CCTCTGGGAAACCGTCTTCTTGCCCGAGGCCCAGATGCTCGTGCCGGTATAGGCGCGTGGCAGCCTCTCCCGGAC
GAGACTCTCATGTTAGTCCTAGAGTTTCTCGACGGCCCGGAGCTAGCTGTTCTTGGCTCAACCTGCAAGTTTATG
CATGCCTTGTGTCGTTCAGACGAGTTGTGGAAGGCTATTTACATCGGGTACGCCTCTTGTTCGAGTCATTGCCTA
AACTATGCCGTGTCTCTGATGCCGCCACTGCAGACTACCCAAGGACCACAGCCACTCACTTCCCTGGCGTGGGTC
TTGGAGAAGCACCGTCCGAGCTTTGCCCAAGGACCGCGATTCCAATGTCGACTGCGGGTGTGTCTTCTCCGACGT
TCTACACCGACCCTTTGCCTGCACCAATATAAACCTGTCGCAATATGTCGCCGACATCCCAGAGACCAACCTCAT
CTCTCGATTCGACTGTCTTACGTACGAAGACTTTGCAGAGCACTGGACCGAGCGGCCCTTCATCTTGACAAGATG
CATACGGGACTGGCCCGCTTGCACCTTTTGGACGCTAGATAGCCTCCTTCGAGACTATGCAGACGTCGAGTTTAG
AGCTGAGGCCGTCGACTGGACGCTACGCCAATATTGGAGCTACATGAACGATAACCAGGACGAGAGTCCCTTGTA
CCTGTTTGATCGTAAATTTGTCGAAAAGATGAAGATAAGGGTCGGTCACGAAGCCGAAGCGGCGTATTGGCGGCC
AGACTGCTTTGGACCGGACCTCTTGGAGGTTCTGGGAATGGAGCGGCCGGCTCATCGTTGGCTGATTGCGGGCCC
CAAAAGGAGCGGCTCAACATTTCACAAAGACCCCAACGGAACTAGCGCCTGGAACGCGGTGATTCAGGGGGCCAA
GTATTGGATCATGTTTCCGCCCGCGGCGTGTGTACCGGGTGTCTACGTTTCGGCGGACAGCAGCGAGGTGACGAG
CCCGCTCAGCATCGCCGAGTGGCTGCTCACCTTTCACCGCGAGGCTCGCCGGCTGCCCGGGTGTGTCGAGGGGGT
TTGTCTCGCCGGTGAGGTTCTCCATGTGCCCAGCGGCTGGTGGCATTTGGTGGTGAATCTTGAGAGTGGCATCGC
CGTGACGCAGAACTTCGTACCCCTTTCGCCGAGCCTAAAGCTCGTCTCTGAGGTGCTGTCCTTTCTACGCGACAA
GCCGGACCAAGTATCGGGCTTCCCGACGACGGTCGAAGATCCCTATGGACTCTTGGTCGATAGACTCCGGGAAGC
ATATCCCGATGTCCTCGACAGGGCGCTGTACCTATCGTCGAAAAGAGGTGGAAATAAGCGCAAATGGGACACGGC
CGTCGAAGAAGCTGGACAGGGATTCAGTTTTGGCTTCGGCGTCGAAGACGACATCGACGTGCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail