Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00394
Gene name
Locationscaffold_01:1667074..1669050
Strand+
Gene length (bp)1976
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 1.2E-23 58 206
PF01061 ABC2_membrane ABC-2 type transporter 1.7E-19 357 566
PF19055 ABC2_membrane_7 ABC-2 type transporter 9.8E-12 237 315

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016020 membrane Yes
GO:0140359 ABC-type transporter activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0110165 cellular anatomical entity No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0022857 transmembrane transporter activity No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0022804 active transmembrane transporter activity No
GO:0005215 transporter activity No
GO:1901265 nucleoside phosphate binding No
GO:0005575 cellular_component No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 375 397 22
2 407 429 22
3 450 472 22
4 487 509 22
5 514 536 22
6 593 612 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00394
MASSSSSAVNTCTDKRSEEDPFQDSGLFNSTVENFSWSGVSVQVKDKKTKELRTIVDNAAGIVQAGDICALMGPS
GCGKTTLLNVLAGRPSQAAKTTATVRVNGLEYPASEFRSLSSFVEQDDVLMSSLTVRETIDFSARLSGLGSSLDR
RRRIDALLSAMGLTDQADNLIGTPLRRGISGGQKRRVSVASQLITGPAVIFLDEPTTSLDSLASFEVISHLRAVA
RRNKLIIILSIHQPSAVTFRLFDKLMLLSAGKTHYFGSLDALHGYYTEVGARIPEHVNPADHLLETLNIDFSTDK
SAASRHLDQLQQAWKASRLADDVTTGINAARRSPYHASNKPPGSHSHNPRPNRLSVLYILCHRGFIKGYRDHMTY
GLRLVMFFVLALMLGTIWIRLDPNQDSVHPRLMLLFIQTGFTSFVAVCYVPAYLEDRHLFKKEYYDALCGATEML
ISNFLVGLPFLLLMCLSFCPIVYWLANFQPTASGTFMYITWIYLDMLAAESAVVFFASLFPSFVAALVAFCTLNS
LFMSICVVIVPSSMLNGFYKYVFRSWDYINYVFQGLVINEFKDRDYSGVSGQIVLDRFEFRANDTPRIVGYLLAI
TAAFRLGAWLALRFS*
Coding >Ophcf2|00394
ATGGCCTCGTCGTCGTCGTCGGCAGTCAACACATGCACGGATAAGCGTTCAGAGGAGGACCCCTTCCAAGACTCG
GGCCTTTTCAACTCGACGGTGGAAAATTTCAGCTGGAGCGGCGTCAGCGTTCAGGTAAAAGACAAGAAGACGAAG
GAACTGCGGACCATTGTCGATAACGCCGCCGGCATCGTCCAAGCGGGTGATATCTGTGCTCTTATGGGCCCTTCA
GGCTGTGGTAAGACGACGCTTCTCAACGTCTTGGCTGGTCGACCGAGTCAGGCCGCAAAGACGACGGCGACTGTC
CGGGTCAACGGTCTCGAGTATCCAGCTTCCGAGTTCCGCAGCTTGTCAAGCTTTGTAGAGCAAGATGACGTTCTC
ATGAGCTCTCTCACCGTCCGCGAGACCATCGATTTCTCCGCCCGTCTATCCGGGCTCGGCTCCTCCCTCGACCGC
CGCCGTCGTATAGATGCCCTCCTCAGCGCCATGGGCCTCACCGACCAGGCAGACAACCTCATCGGCACGCCCCTC
CGCCGCGGCATCTCGGGCGGACAGAAGCGTCGTGTCAGCGTCGCCAGCCAGCTCATAACCGGCCCCGCCGTCATC
TTCCTGGACGAGCCAACCACCAGCCTCGATTCCCTCGCCAGCTTCGAAGTCATCAGCCATCTCCGGGCCGTGGCG
CGTAGAAATAAACTAATCATCATCCTGTCTATACACCAGCCTTCGGCCGTCACCTTTCGCCTCTTTGATAAGCTG
ATGCTTCTCTCGGCTGGGAAGACGCATTACTTTGGTTCTCTTGATGCTCTTCACGGTTACTATACCGAAGTAGGC
GCCAGAATTCCGGAACACGTCAACCCAGCCGACCACCTCCTCGAGACGCTCAATATCGACTTCTCCACCGACAAA
TCCGCTGCCTCGAGACATCTCGACCAGCTGCAACAGGCGTGGAAAGCCTCTCGACTGGCAGACGACGTCACCACC
GGTATCAACGCCGCTCGCCGCTCACCATATCATGCCTCAAACAAGCCTCCCGGCTCTCACTCTCACAACCCGAGG
CCCAACAGGCTCAGCGTCTTGTACATCCTCTGCCATCGAGGCTTCATCAAGGGTTATCGCGATCACATGACCTAC
GGCCTCCGACTAGTCATGTTCTTCGTTTTGGCTCTCATGTTGGGCACCATATGGATCCGTCTCGATCCGAACCAG
GACTCGGTCCACCCGCGATTGATGCTTCTCTTCATTCAAACTGGCTTTACCTCCTTCGTCGCCGTCTGTTATGTG
CCCGCCTACCTCGAGGACCGCCATCTCTTTAAGAAAGAATACTACGACGCCTTGTGTGGCGCGACGGAGATGCTT
ATATCCAACTTTCTCGTCGGACTTCCCTTTCTCCTGCTTATGTGCCTTAGCTTCTGTCCCATAGTCTACTGGCTG
GCCAACTTTCAGCCCACAGCGTCGGGCACCTTTATGTACATTACCTGGATATACCTCGACATGCTAGCAGCAGAA
TCCGCCGTCGTGTTCTTCGCCTCGTTGTTCCCCAGCTTCGTCGCCGCCCTCGTCGCCTTCTGTACGCTTAACTCC
TTGTTCATGTCTATTTGCGTCGTTATAGTTCCGTCATCGATGCTCAATGGCTTCTACAAATACGTCTTTCGATCT
TGGGACTATATCAACTATGTCTTTCAGGGGCTAGTCATTAATGAGTTTAAGGATCGCGACTACTCCGGCGTTAGC
GGACAGATCGTGCTGGATCGCTTCGAATTCAGGGCAAACGATACCCCGAGAATCGTGGGTTATCTTCTTGCCATC
ACTGCCGCGTTCCGTCTTGGGGCTTGGCTTGCGCTGAGATTTTCTTGA
Transcript >Ophcf2|00394
ATGGCCTCGTCGTCGTCGTCGGCAGTCAACACATGCACGGATAAGCGTTCAGAGGAGGACCCCTTCCAAGACTCG
GGCCTTTTCAACTCGACGGTGGAAAATTTCAGCTGGAGCGGCGTCAGCGTTCAGGTAAAAGACAAGAAGACGAAG
GAACTGCGGACCATTGTCGATAACGCCGCCGGCATCGTCCAAGCGGGTGATATCTGTGCTCTTATGGGCCCTTCA
GGCTGTGGTAAGACGACGCTTCTCAACGTCTTGGCTGGTCGACCGAGTCAGGCCGCAAAGACGACGGCGACTGTC
CGGGTCAACGGTCTCGAGTATCCAGCTTCCGAGTTCCGCAGCTTGTCAAGCTTTGTAGAGCAAGATGACGTTCTC
ATGAGCTCTCTCACCGTCCGCGAGACCATCGATTTCTCCGCCCGTCTATCCGGGCTCGGCTCCTCCCTCGACCGC
CGCCGTCGTATAGATGCCCTCCTCAGCGCCATGGGCCTCACCGACCAGGCAGACAACCTCATCGGCACGCCCCTC
CGCCGCGGCATCTCGGGCGGACAGAAGCGTCGTGTCAGCGTCGCCAGCCAGCTCATAACCGGCCCCGCCGTCATC
TTCCTGGACGAGCCAACCACCAGCCTCGATTCCCTCGCCAGCTTCGAAGTCATCAGCCATCTCCGGGCCGTGGCG
CGTAGAAATAAACTAATCATCATCCTGTCTATACACCAGCCTTCGGCCGTCACCTTTCGCCTCTTTGATAAGCTG
ATGCTTCTCTCGGCTGGGAAGACGCATTACTTTGGTTCTCTTGATGCTCTTCACGGTTACTATACCGAAGTAGGC
GCCAGAATTCCGGAACACGTCAACCCAGCCGACCACCTCCTCGAGACGCTCAATATCGACTTCTCCACCGACAAA
TCCGCTGCCTCGAGACATCTCGACCAGCTGCAACAGGCGTGGAAAGCCTCTCGACTGGCAGACGACGTCACCACC
GGTATCAACGCCGCTCGCCGCTCACCATATCATGCCTCAAACAAGCCTCCCGGCTCTCACTCTCACAACCCGAGG
CCCAACAGGCTCAGCGTCTTGTACATCCTCTGCCATCGAGGCTTCATCAAGGGTTATCGCGATCACATGACCTAC
GGCCTCCGACTAGTCATGTTCTTCGTTTTGGCTCTCATGTTGGGCACCATATGGATCCGTCTCGATCCGAACCAG
GACTCGGTCCACCCGCGATTGATGCTTCTCTTCATTCAAACTGGCTTTACCTCCTTCGTCGCCGTCTGTTATGTG
CCCGCCTACCTCGAGGACCGCCATCTCTTTAAGAAAGAATACTACGACGCCTTGTGTGGCGCGACGGAGATGCTT
ATATCCAACTTTCTCGTCGGACTTCCCTTTCTCCTGCTTATGTGCCTTAGCTTCTGTCCCATAGTCTACTGGCTG
GCCAACTTTCAGCCCACAGCGTCGGGCACCTTTATGTACATTACCTGGATATACCTCGACATGCTAGCAGCAGAA
TCCGCCGTCGTGTTCTTCGCCTCGTTGTTCCCCAGCTTCGTCGCCGCCCTCGTCGCCTTCTGTACGCTTAACTCC
TTGTTCATGTCTATTTGCGTCGTTATAGTTCCGTCATCGATGCTCAATGGCTTCTACAAATACGTCTTTCGATCT
TGGGACTATATCAACTATGTCTTTCAGGGGCTAGTCATTAATGAGTTTAAGGATCGCGACTACTCCGGCGTTAGC
GGACAGATCGTGCTGGATCGCTTCGAATTCAGGGCAAACGATACCCCGAGAATCGTGGGTTATCTTCTTGCCATC
ACTGCCGCGTTCCGTCTTGGGGCTTGGCTTGCGCTGAGATTTTCTTGA
Gene >Ophcf2|00394
ATGGCCTCGTCGTCGTCGTCGGCAGTCAACACATGCACGGATAAGCGTTCAGAGGAGGACCCCTTCCAAGACTCG
GGCCTTTTCAACTCGACGGTGGAAAATTTCAGCTGGAGCGGCGTCAGCGTTCAGGTAAAAGACAAGAAGACGAAG
GAACTGCGGACCATTGTCGATAACGCCGCCGGCATCGTCCAAGCGGGTATGTATTATTAAACGACCAGTATCTCA
CCCGTTGTTTTTGCCGTTGCTGATTTCAATATCACAAGGTGATATCTGTGCTCTTATGGGCCCTTCAGGCTGTGG
TAAGACGACGCTTCTCAACGTCTTGGCTGGTCGACCGAGTCAGGCCGCAAAGACGACGGCGACTGTCCGGGTCAA
CGGTCTCGAGTATCCAGCTTCCGAGTTCCGCAGCTTGTCAAGCTTTGTAGAGCAAGATGACGTTCTCATGAGCTC
TCTCACCGTCCGCGAGACCATCGATTTCTCCGCCCGTCTATCCGGGCTCGGGTAACAAACACCAGACTGCGAGCC
ATCATCACAGACAACAAACTAACACGACCCTCAACAGCTCCTCCCTCGACCGCCGCCGTCGTATAGATGCCCTCC
TCAGCGCCATGGGCCTCACCGACCAGGCAGACAACCTCATCGGCACGCCCCTCCGCCGCGGCATCTCGGGCGGAC
AGAAGCGTCGTGTCAGCGTCGCCAGCCAGCTCATAACCGGCCCCGCCGTCATCTTCCTGGACGAGCCAACCACCA
GCCTCGATTCCCTCGCCAGCTTCGAAGTCATCAGCCATCTCCGGGCCGTGGCGCGTAGAAATAAACTAATCATCA
TCCTGTCTATACACCAGCCTTCGGCCGTCACCTTTCGCCTCTTTGATAAGCTGATGCTTCTCTCGGCTGGGAAGA
CGCATTACTTTGGTTCTCTTGATGCTCTTCACGGTTACTATACCGAAGTAGGCGCCAGAATTCCGGAACACGTCA
ACCCAGCCGACCACCTCCTCGAGACGCTCAATATCGACTTCTCCACCGACAAATCCGCTGCCTCGAGACATCTCG
ACCAGCTGCAACAGGCGTGGAAAGCCTCTCGACTGGCAGACGACGTCACCACCGGTATCAACGCCGCTCGCCGCT
CACCATATCATGCCTCAAACAAGCCTCCCGGCTCTCACTCTCACAACCCGAGGCCCAACAGGCTCAGCGTCTTGT
ACATCCTCTGCCATCGAGGCTTCATCAAGGGTTATCGCGATCACATGACCTACGGCCTCCGACTAGTCATGTTCT
TCGTTTTGGCTCTCATGTTGGGCACCATATGGATCCGTCTCGATCCGAACCAGGACTCGGTCCACCCGCGATTGA
TGCTTCTCTTCATTCAAACTGGCTTTACCTCCTTCGTCGCCGTCTGTTATGTGCCCGCCTACCTCGAGGACCGCC
ATCTCTTTAAGAAAGAATACTACGACGCCTTGTGTGGCGCGACGGAGATGCTTATATCCAACTTTCTCGTCGGAC
TTCCCTTTCTCCTGCTTATGTGCCTTAGCTTCTGTCCCATAGTCTACTGGCTGGCCAACTTTCAGCCCACAGCGT
CGGGCACCTTTATGTACATTACCTGGATATACCTCGACATGCTAGCAGCAGAATCCGCCGTCGTGTTCTTCGCCT
CGTTGTTCCCCAGCTTCGTCGCCGCCCTCGTCGCCTTCTGTACGCTTAACTCCTTGTTCATGTCTATTTGCGTCG
TTATAGTTCCGTCATCGATGCTCAATGGCTTCTACAAATACGTCTTTCGATCTTGGGACTATATCAACTATGTCT
TTCAGGGGCTAGTCATTAATGAGTTTAAGGATCGCGACTACTCCGGCGTTAGCGGACAGATCGTGCTGGATCGCT
TCGAATTCAGGGCAAACGATACCCCGAGAATCGTGGGTTATCTTCTTGCCATCACTGCCGCGTTCCGTCTTGGGG
CTTGGCTTGCGCTGAGATTTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail