Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00393
Gene name
Locationscaffold_01:1662801..1664889
Strand-
Gene length (bp)2088
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 2.7E-49 290 566
PF18916 Lycopene_cyc Lycopene cyclase 2.9E-05 5 94
PF18916 Lycopene_cyc Lycopene cyclase 5.4E-01 151 228

GO

GO Term Description Terminal node
GO:0016872 intramolecular lyase activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 55 22
3 76 98 22
4 113 135 22
5 142 164 22
6 174 196 22
7 216 238 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00393
MGYAYWLVHLTWTVPPAVLMTGLYWPFLTRLELYKILTLIGISLVAATPWDSYLIRNRIWFYPPDAIAGPRLFSI
PLEEFFFFIVLTYNTSLLYVLTTKPLVLPTYLVRRPRALAVDCVVLAVVFVAAVAAVRSGGRGTYMGFIVVWATP
FVAFLWVLSHRFLLALPRKTILLVILVPSVYLCFVDNLVLQRGTWVIENKTKLDIQVLGSLDIEEAFFFFITSLL
IVMGLVSIDHAVALAEYEAATSPAADELHLPSYGSIMISYLWRRRDPLDLVFLQSLAEAVDLTSKKSQSMFIGSA
IFEGALRIDLIRLYSFYRTVDDLVDDSPDDEAARLAIQQCSEAIKARFGSRWKQADGLQYDWQNCVSGLKEEQLA
PCLRSSVAQLPASRLTPEPLSHLLDGMQTDLVFSAPTRSYPIETEKDLETYAYNVAGSVAAAILGLVSHYYHPST
RAELQQRVLRAGEAMGCALQYVNIARDVGRDAAIGRVYIPNSWLRSEGLTAAEIVADPCRSQVVKLRRRMLDKAE
TTYEANVGAIHELPREIRGPMMTVVDSYLAIGKTVRKLPVESLGWKGKTRLPLLRRLVVVRQALIKANKGRGD*
Coding >Ophcf2|00393
ATGGGATACGCGTACTGGCTTGTCCACTTGACGTGGACGGTGCCGCCGGCGGTGCTGATGACGGGCTTATACTGG
CCTTTTCTGACGCGTCTGGAGCTGTACAAGATATTGACGCTCATAGGTATTTCATTAGTGGCTGCGACGCCATGG
GATTCATATCTCATACGCAATCGAATCTGGTTCTACCCGCCCGACGCCATAGCCGGTCCAAGGCTCTTCTCCATC
CCGTTGGAAGAGTTCTTCTTCTTCATCGTGCTGACCTACAACACGTCACTTCTGTACGTGCTGACGACGAAGCCC
TTGGTCTTGCCCACGTATCTCGTCCGGCGGCCGAGGGCGCTGGCGGTGGACTGCGTCGTCTTGGCTGTCGTCTTC
GTTGCTGCTGTTGCGGCTGTGAGGTCGGGAGGACGGGGCACGTATATGGGCTTTATTGTTGTTTGGGCTACGCCT
TTTGTCGCGTTTCTTTGGGTCCTTTCTCATCGGTTTTTGCTGGCTTTGCCGCGGAAGACGATTCTCTTGGTCATA
TTGGTTCCCTCCGTTTACCTCTGCTTCGTGGATAATCTTGTGCTACAGCGCGGAACATGGGTCATCGAGAACAAG
ACCAAGTTGGATATCCAAGTGCTGGGATCCCTCGATATCGAAGAAGCCTTCTTCTTCTTCATAACAAGCCTTCTC
ATCGTCATGGGCCTCGTCAGCATCGACCACGCCGTAGCTCTGGCCGAGTATGAAGCCGCAACCTCGCCAGCTGCT
GACGAGCTGCATCTCCCGTCATACGGAAGCATCATGATTTCCTACCTTTGGAGACGAAGAGACCCGCTCGACCTT
GTTTTTCTGCAGTCATTGGCTGAAGCTGTTGATCTCACGTCCAAGAAGAGCCAGAGCATGTTCATCGGAAGCGCC
ATATTCGAGGGCGCGTTACGTATTGATCTTATCCGACTATATTCCTTTTACCGCACTGTCGATGACCTCGTCGAC
GATTCCCCCGATGACGAAGCCGCCAGACTCGCCATCCAGCAGTGCTCCGAAGCCATCAAAGCCCGGTTCGGCTCC
AGATGGAAACAGGCAGACGGCTTGCAGTACGATTGGCAGAATTGCGTCTCCGGGCTCAAGGAGGAGCAGCTGGCC
CCTTGTCTCCGCTCATCCGTCGCCCAACTCCCGGCTTCGCGTCTTACCCCTGAGCCCCTTTCCCATCTCCTAGAC
GGCATGCAGACCGATCTCGTCTTCTCGGCTCCGACGAGGAGCTACCCGATCGAGACGGAGAAAGACCTCGAGACA
TACGCCTACAACGTAGCTGGTTCCGTCGCGGCCGCCATCCTCGGCCTCGTCTCTCACTACTACCACCCATCGACC
CGTGCCGAACTTCAGCAGCGCGTCCTCCGGGCGGGTGAGGCCATGGGCTGCGCGTTACAGTACGTCAATATAGCG
AGGGACGTCGGTCGAGATGCCGCCATCGGACGAGTCTACATTCCAAACTCATGGCTTCGCAGCGAGGGCCTGACT
GCAGCCGAAATCGTGGCCGATCCGTGCCGATCACAGGTAGTGAAGCTGAGGCGCAGGATGCTCGACAAGGCTGAG
ACGACGTATGAGGCCAACGTCGGCGCTATACATGAGCTTCCGCGCGAGATTCGCGGGCCCATGATGACGGTTGTC
GACAGTTACTTGGCTATTGGCAAGACGGTGAGGAAGCTGCCGGTTGAGTCTCTGGGATGGAAGGGGAAGACGAGG
TTGCCTTTGTTGCGGAGGCTGGTTGTCGTGAGGCAGGCCTTGATCAAGGCTAACAAGGGACGGGGGGACTAG
Transcript >Ophcf2|00393
ATGGGATACGCGTACTGGCTTGTCCACTTGACGTGGACGGTGCCGCCGGCGGTGCTGATGACGGGCTTATACTGG
CCTTTTCTGACGCGTCTGGAGCTGTACAAGATATTGACGCTCATAGGTATTTCATTAGTGGCTGCGACGCCATGG
GATTCATATCTCATACGCAATCGAATCTGGTTCTACCCGCCCGACGCCATAGCCGGTCCAAGGCTCTTCTCCATC
CCGTTGGAAGAGTTCTTCTTCTTCATCGTGCTGACCTACAACACGTCACTTCTGTACGTGCTGACGACGAAGCCC
TTGGTCTTGCCCACGTATCTCGTCCGGCGGCCGAGGGCGCTGGCGGTGGACTGCGTCGTCTTGGCTGTCGTCTTC
GTTGCTGCTGTTGCGGCTGTGAGGTCGGGAGGACGGGGCACGTATATGGGCTTTATTGTTGTTTGGGCTACGCCT
TTTGTCGCGTTTCTTTGGGTCCTTTCTCATCGGTTTTTGCTGGCTTTGCCGCGGAAGACGATTCTCTTGGTCATA
TTGGTTCCCTCCGTTTACCTCTGCTTCGTGGATAATCTTGTGCTACAGCGCGGAACATGGGTCATCGAGAACAAG
ACCAAGTTGGATATCCAAGTGCTGGGATCCCTCGATATCGAAGAAGCCTTCTTCTTCTTCATAACAAGCCTTCTC
ATCGTCATGGGCCTCGTCAGCATCGACCACGCCGTAGCTCTGGCCGAGTATGAAGCCGCAACCTCGCCAGCTGCT
GACGAGCTGCATCTCCCGTCATACGGAAGCATCATGATTTCCTACCTTTGGAGACGAAGAGACCCGCTCGACCTT
GTTTTTCTGCAGTCATTGGCTGAAGCTGTTGATCTCACGTCCAAGAAGAGCCAGAGCATGTTCATCGGAAGCGCC
ATATTCGAGGGCGCGTTACGTATTGATCTTATCCGACTATATTCCTTTTACCGCACTGTCGATGACCTCGTCGAC
GATTCCCCCGATGACGAAGCCGCCAGACTCGCCATCCAGCAGTGCTCCGAAGCCATCAAAGCCCGGTTCGGCTCC
AGATGGAAACAGGCAGACGGCTTGCAGTACGATTGGCAGAATTGCGTCTCCGGGCTCAAGGAGGAGCAGCTGGCC
CCTTGTCTCCGCTCATCCGTCGCCCAACTCCCGGCTTCGCGTCTTACCCCTGAGCCCCTTTCCCATCTCCTAGAC
GGCATGCAGACCGATCTCGTCTTCTCGGCTCCGACGAGGAGCTACCCGATCGAGACGGAGAAAGACCTCGAGACA
TACGCCTACAACGTAGCTGGTTCCGTCGCGGCCGCCATCCTCGGCCTCGTCTCTCACTACTACCACCCATCGACC
CGTGCCGAACTTCAGCAGCGCGTCCTCCGGGCGGGTGAGGCCATGGGCTGCGCGTTACAGTACGTCAATATAGCG
AGGGACGTCGGTCGAGATGCCGCCATCGGACGAGTCTACATTCCAAACTCATGGCTTCGCAGCGAGGGCCTGACT
GCAGCCGAAATCGTGGCCGATCCGTGCCGATCACAGGTAGTGAAGCTGAGGCGCAGGATGCTCGACAAGGCTGAG
ACGACGTATGAGGCCAACGTCGGCGCTATACATGAGCTTCCGCGCGAGATTCGCGGGCCCATGATGACGGTTGTC
GACAGTTACTTGGCTATTGGCAAGACGGTGAGGAAGCTGCCGGTTGAGTCTCTGGGATGGAAGGGGAAGACGAGG
TTGCCTTTGTTGCGGAGGCTGGTTGTCGTGAGGCAGGCCTTGATCAAGGCTAACAAGGGACGGGGGGACTAG
Gene >Ophcf2|00393
ATGGGATACGCGTACTGGCTTGTGTAGGTAGCCCCTATTCGTCCGTCTCAGCTTGCGTCTGACCTCGACTAGCCA
CTTGACGTGGACGGTGCCGCCGGCGGTGCTGATGACGGGCTTATACTGGCCTTTTCTGACGCGTCTGGAGCTGTA
CAAGATATTGACGCTCATAGGTGTACGTCGTCGATACGCCGTATTCACGCCAGGATCATGAACTCACGTAGCCTT
GAATAGATTTCATTAGTGGCTGCGACGCCATGGGATTCATATCTCATACGCAATCGAATCTGGTTCTACCCGCCC
GACGCCATAGCCGGTCCAAGGCTCTTCTCCATCCCGTTGGAAGAGTTCTTCTTCTTCATCGTGCTGACCTACAAC
ACGTCACTTCTGTACGTGCTGACGACGAAGCCCTTGGTCTTGCCCACGTATCTCGTCCGGCGGCCGAGGGCGCTG
GCGGTGGACTGCGTCGTCTTGGCTGTCGTCTTCGTTGCTGCTGTTGCGGCTGTGAGGTCGGGAGGACGGGGCACG
TATATGGGCTTTATTGTTGTTTGGGCTACGCCTTTTGTCGCGTTTCTTTGGTGAGTGATGTTGTCAAGTGTTTGG
TGATGGTTTGTTCGAGGCTGACGGGATGATATAGGGTCCTTTCTCATCGGTTTTTGCTGGCTTTGCCGCGGAAGA
CGATTCTCTTGGTCATATTGGTTCCCTCCGTTTACCTCTGCTTCGTGGATAATCTTGTGCTACAGCGCGGAACAT
GGGTCATCGAGAACAAGACCAAGTTGGATATCCAAGTGCTGGGATCCCTCGATATCGAGTGCGTGCTGCTATTGC
TACGTACTCGGACTCTCGACCAAACTGCTAACACGACATAGAGAAGCCTTCTTCTTCTTCATAACAAGCCTTCTC
ATCGTCATGGGCCTCGTCAGCATCGACCACGCCGTAGCTCTGGCCGAGTATGAAGCCGCAACCTCGCCAGCTGCT
GACGAGCTGCATCTCCCGTCATACGGAAGCATCATGATTTCCTACCTTTGGAGACGAAGAGACCCGCTCGACCTT
GTTTTTCTGCAGTCATTGGCTGAAGCTGTTGATCTCACGTCCAAGAAGAGCCAGAGCATGTTCATCGGAAGCGCC
ATATTCGAGGGCGCGTTACGTATTGATCTTATCCGACTGTATGAACGCTCTCTCTCTCTCTCTCTCTCTCTCGCT
TATATAGACGTATGCATCTGACAAGACAGATATTCCTTTTACCGCACTGTCGATGACCTCGTCGACGATTCCCCC
GATGACGAAGCCGCCAGACTCGCCATCCAGCAGTGCTCCGAAGCCATCAAAGCCCGGTTCGGCTCCAGATGGAAA
CAGGCAGACGGCTTGCAGTACGATTGGCAGAATTGCGTCTCCGGGCTCAAGGAGGAGCAGCTGGCCCCTTGTCTC
CGCTCATCCGTCGCCCAACTCCCGGCTTCGCGTCTTACCCCTGAGCCCCTTTCCCATCTCCTAGACGGCATGCAG
ACCGATCTCGTCTTCTCGGCTCCGACGAGGAGCTACCCGATCGAGACGGAGAAAGACCTCGAGACATACGCCTAC
AACGTAGCTGGTTCCGTCGCGGCCGCCATCCTCGGCCTCGTCTCTCACTACTACCACCCATCGACCCGTGCCGAA
CTTCAGCAGCGCGTCCTCCGGGCGGGTGAGGCCATGGGCTGCGCGTTACAGTACGTCAATATAGCGAGGGACGTC
GGTCGAGATGCCGCCATCGGACGAGTCTACATTCCAAACTCATGGCTTCGCAGCGAGGGCCTGACTGCAGCCGAA
ATCGTGGCCGATCCGTGCCGATCACAGGTAGTGAAGCTGAGGCGCAGGATGCTCGACAAGGCTGAGACGACGTAT
GAGGCCAACGTCGGCGCTATACATGAGCTTCCGCGCGAGATTCGCGGGCCCATGATGACGGTTGTCGACAGTTAC
TTGGCTATTGGCAAGACGGTGAGGAAGCTGCCGGTTGAGTCTCTGGGATGGAAGGGGAAGACGAGGTTGCCTTTG
TTGCGGAGGCTGGTTGTCGTGAGGCAGGCCTTGATCAAGGCTAACAAGGGACGGGGGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail