Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00392
Gene name
Locationscaffold_01:1660719..1662766
Strand+
Gene length (bp)2047
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.0E-25 15 482
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-14 8 69
PF01266 DAO FAD dependent oxidoreductase 3.7E-13 7 286
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.6E-06 7 44
PF00890 FAD_binding_2 FAD binding domain 4.0E-06 6 40

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Mitochondrion|Peroxisome Peroxisomal targeting signal 0.492 0.2182 0.1648 0.0639 0.775 0.177 0.2112 0.2706 0.3278 0.7375

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2976
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4995
Ophiocordyceps australis map64 (Brazil) OphauB2|2325
Ophiocordyceps camponoti-floridani Ophcf2|00392 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3963
Ophiocordyceps kimflemingae Ophio5|2526
Ophiocordyceps subramaniannii Hirsu2|5083
Ophiocordyceps subramaniannii Hirsu2|9754

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00392
MIQPTAIVIGAGAGGVATAARLAQRGFRVTVVEKNEFTGGRCSLIHRDGYRFDQGPSLLLMPEIFHQTFRELGTS
LAEEGVHLFRCQPNYCVWFSDNDCFQLSTDLADLATQIERHEGSQGIQGLLSFLRESGRHYDISIAQVLYRNFPS
LRALLRSGFLLNVGKMHPFESNHHRVSRYFKSDKMRRVFTFASMYLGMSPFDAPGTYSLLQYTELMHGVSYPEGG
FQKVLDALVKIGQRNGVEYRLGTPVSKILISNDKTAGGVQLKSGQELHADVVIVNADLVWAYNNLLPPSPYASRL
QTRDASCSSLSYFWSFDRLIPELKGHNVFLAEEYRQSFDAIFKRHTIPDEPSFYVNVPSRIDASAAPPGKDAVVV
LVPIGHLDGAFSQVDMDRLVASTRDFVLDTIETRTGARGLRESLIRESVDTPLSWESKFNLDRGAILGLSHSFFN
VLSFRPGIKHDSIDRLYFVGASTHPGTGVPVCLAGSKIQQQQQRKYDNSMYKSSLLKRSNLDMVNKAPLISTAL*
Coding >Ophcf2|00392
ATGATCCAACCTACGGCCATCGTCATCGGAGCCGGTGCTGGGGGCGTGGCTACGGCTGCGCGTCTCGCCCAGCGC
GGCTTCAGGGTTACGGTGGTTGAGAAGAATGAGTTTACGGGGGGGAGATGCTCTCTCATCCATCGAGACGGTTAC
CGCTTCGATCAAGGACCCTCCCTCCTCCTCATGCCCGAAATCTTCCACCAGACCTTCCGCGAACTCGGCACTTCG
CTGGCCGAAGAGGGCGTTCATCTCTTCCGCTGTCAGCCAAACTACTGCGTCTGGTTCTCCGACAACGACTGCTTC
CAGCTCTCAACCGACCTTGCCGACCTGGCAACTCAGATTGAGCGGCACGAAGGCAGCCAGGGCATACAGGGCTTG
CTGTCGTTTCTGCGAGAGTCCGGGAGACATTACGATATCTCGATTGCGCAGGTGCTGTATCGCAACTTTCCCAGT
TTGCGGGCGTTGCTGAGGTCGGGCTTTCTCTTGAATGTTGGCAAGATGCACCCGTTTGAGAGCAATCATCATCGC
GTCAGTCGGTATTTCAAGTCGGACAAGATGCGGCGTGTCTTTACCTTTGCCAGCATGTATCTCGGCATGAGTCCC
TTTGACGCGCCGGGGACGTATTCATTGCTGCAGTATACCGAGTTGATGCATGGAGTTTCGTATCCGGAGGGGGGG
TTTCAGAAGGTTCTCGATGCCCTCGTCAAGATCGGGCAGAGAAACGGAGTGGAATATCGTCTCGGAACTCCAGTC
TCCAAGATCCTCATCTCAAACGACAAGACGGCCGGCGGAGTCCAGCTCAAGTCAGGCCAAGAACTGCACGCCGAC
GTCGTCATCGTCAACGCCGATCTCGTCTGGGCCTACAACAACCTCCTTCCGCCCTCACCCTACGCTTCGAGACTG
CAGACGAGGGACGCCTCGTGCAGCAGCCTCTCCTATTTCTGGTCCTTTGACAGGCTCATCCCCGAGCTCAAGGGT
CACAACGTCTTTCTTGCGGAGGAGTATCGTCAGAGCTTCGACGCCATCTTCAAGCGTCATACCATCCCTGACGAG
CCGTCCTTTTATGTCAACGTGCCCAGTAGGATTGACGCCTCGGCCGCACCGCCGGGGAAGGATGCCGTTGTCGTC
CTGGTTCCCATAGGACATCTCGACGGGGCTTTCAGCCAGGTTGATATGGACCGTCTAGTCGCTTCTACGCGGGAC
TTTGTCCTCGACACCATCGAGACTCGTACGGGAGCCCGAGGCCTGCGAGAGTCCCTGATTCGAGAGTCGGTGGAC
ACGCCCCTGAGCTGGGAATCCAAGTTCAACCTTGACCGGGGCGCCATCCTCGGCCTATCTCACTCCTTCTTCAAC
GTCCTGAGTTTCAGACCGGGCATCAAGCATGACAGTATCGACAGGCTGTATTTCGTCGGCGCCAGCACGCACCCT
GGAACGGGAGTCCCCGTCTGTCTGGCGGGGAGCAAGATTCAGCAGCAGCAGCAGCGCAAGTACGACAACTCCATG
TACAAAAGTAGTCTGCTCAAAAGAAGCAACCTGGATATGGTGAACAAGGCCCCCTTAATCTCTACAGCCTTGTAA
Transcript >Ophcf2|00392
ATGATCCAACCTACGGCCATCGTCATCGGAGCCGGTGCTGGGGGCGTGGCTACGGCTGCGCGTCTCGCCCAGCGC
GGCTTCAGGGTTACGGTGGTTGAGAAGAATGAGTTTACGGGGGGGAGATGCTCTCTCATCCATCGAGACGGTTAC
CGCTTCGATCAAGGACCCTCCCTCCTCCTCATGCCCGAAATCTTCCACCAGACCTTCCGCGAACTCGGCACTTCG
CTGGCCGAAGAGGGCGTTCATCTCTTCCGCTGTCAGCCAAACTACTGCGTCTGGTTCTCCGACAACGACTGCTTC
CAGCTCTCAACCGACCTTGCCGACCTGGCAACTCAGATTGAGCGGCACGAAGGCAGCCAGGGCATACAGGGCTTG
CTGTCGTTTCTGCGAGAGTCCGGGAGACATTACGATATCTCGATTGCGCAGGTGCTGTATCGCAACTTTCCCAGT
TTGCGGGCGTTGCTGAGGTCGGGCTTTCTCTTGAATGTTGGCAAGATGCACCCGTTTGAGAGCAATCATCATCGC
GTCAGTCGGTATTTCAAGTCGGACAAGATGCGGCGTGTCTTTACCTTTGCCAGCATGTATCTCGGCATGAGTCCC
TTTGACGCGCCGGGGACGTATTCATTGCTGCAGTATACCGAGTTGATGCATGGAGTTTCGTATCCGGAGGGGGGG
TTTCAGAAGGTTCTCGATGCCCTCGTCAAGATCGGGCAGAGAAACGGAGTGGAATATCGTCTCGGAACTCCAGTC
TCCAAGATCCTCATCTCAAACGACAAGACGGCCGGCGGAGTCCAGCTCAAGTCAGGCCAAGAACTGCACGCCGAC
GTCGTCATCGTCAACGCCGATCTCGTCTGGGCCTACAACAACCTCCTTCCGCCCTCACCCTACGCTTCGAGACTG
CAGACGAGGGACGCCTCGTGCAGCAGCCTCTCCTATTTCTGGTCCTTTGACAGGCTCATCCCCGAGCTCAAGGGT
CACAACGTCTTTCTTGCGGAGGAGTATCGTCAGAGCTTCGACGCCATCTTCAAGCGTCATACCATCCCTGACGAG
CCGTCCTTTTATGTCAACGTGCCCAGTAGGATTGACGCCTCGGCCGCACCGCCGGGGAAGGATGCCGTTGTCGTC
CTGGTTCCCATAGGACATCTCGACGGGGCTTTCAGCCAGGTTGATATGGACCGTCTAGTCGCTTCTACGCGGGAC
TTTGTCCTCGACACCATCGAGACTCGTACGGGAGCCCGAGGCCTGCGAGAGTCCCTGATTCGAGAGTCGGTGGAC
ACGCCCCTGAGCTGGGAATCCAAGTTCAACCTTGACCGGGGCGCCATCCTCGGCCTATCTCACTCCTTCTTCAAC
GTCCTGAGTTTCAGACCGGGCATCAAGCATGACAGTATCGACAGGCTGTATTTCGTCGGCGCCAGCACGCACCCT
GGAACGGGAGTCCCCGTCTGTCTGGCGGGGAGCAAGATTCAGCAGCAGCAGCAGCGCAAGTACGACAACTCCATG
TACAAAAGTAGTCTGCTCAAAAGAAGCAACCTGGATATGGTGAACAAGGCCCCCTTAATCTCTACAGCCTTGTAA
Gene >Ophcf2|00392
ATGATCCAACCTACGGCCATCGTCATCGGTGAGTCTTCACAGCCAGCCTTGCGCGAGTTTGTCCCTGACTGGCGT
ATCTTGTGTCTTCAATACAGGAGCCGGTGCTGGGGGCGTGGCTACGGCTGCGCGTCTCGCCCAGCGCGGCTTCAG
GGTTACGGTGGTTGAGAAGAATGAGTTTACGGGGGGGAGATGCTCTCTCATCCATCGAGACGGTTACGTGAGTTG
CCAGTAAAACACCACACATGTCAATGATATACATGTACAGCTTGAAACATACCACGTAGCTGGATAACAAGGCAA
CTTATTGATGACGTCTATCAACAGCGCTTCGATCAAGGACCCTCCCTCCTCCTCATGCCCGAAATCTTCCACCAG
ACCTTCCGCGAACTCGGCACTTCGCTGGCCGAAGAGGGCGTTCATCTCTTCCGCTGTCAGCCAAACTACTGCGTC
TGGTTCTCCGACAACGACTGCTTCCAGCTCTCAACCGACCTTGCCGACCTGGCAACTCAGATTGAGCGGCACGAA
GGCAGCCAGGGCATACAGGGCTTGCTGTCGTTTCTGCGAGAGTCCGGGAGACATTACGATATCTCGATTGCGCAG
GTGCTGTATCGCAACTTTCCCAGTTTGCGGGCGTTGCTGAGGTCGGGCTTTCTCTTGAATGTTGGCAAGATGCAC
CCGTTTGAGAGCAATCATCATCGCGTCAGTCGGTATTTCAAGTCGGACAAGATGCGGCGTGTCTTTACCTTTGCC
AGCATGTATCTCGGCATGAGTCCCTTTGACGCGCCGGGGACGTATTCATTGCTGCAGTATACCGAGTTGATGCAT
GGAGTTTCGTATCCGGAGGGGGGGTTTCAGAAGGTGAGTTGCGTATGATGAGAAATCTGACCATGGCTTCAAACG
AAACTAAACATGAACTCAACTCCAGGTTCTCGATGCCCTCGTCAAGATCGGGCAGAGAAACGGAGTGGAATATCG
TCTCGGAACTCCAGTCTCCAAGATCCTCATCTCAAACGACAAGACGGCCGGCGGAGTCCAGCTCAAGTCAGGCCA
AGAACTGCACGCCGACGTCGTCATCGTCAACGCCGATCTCGTCTGGGCCTACAACAACCTCCTTCCGCCCTCACC
CTACGCTTCGAGACTGCAGACGAGGGACGCCTCGTGCAGCAGCCTCTCCTATTTCTGGTCCTTTGACAGGCTCAT
CCCCGAGCTCAAGGGTCACAACGTCTTTCTTGCGGAGGAGTATCGTCAGAGCTTCGACGCCATCTTCAAGCGTCA
TACCATCCCTGACGAGCCGTCCTTTTATGTCAACGTGCCCAGTAGGATTGACGCCTCGGCCGCACCGCCGGGGAA
GGATGCCGTTGTCGTCCTGGTTCCCATAGGACATCTCGACGGGGCTTTCAGCCAGGTTGATATGGACCGTCTAGT
CGCTTCTACGCGGGACTTTGTCCTCGACACCATCGAGACTCGTACGGGAGCCCGAGGCCTGCGAGAGTCCCTGAT
TCGAGAGTCGGTGGACACGCCCCTGAGCTGGGAATCCAAGTTCAACCTTGACCGGGGCGCCATCCTCGGCCTATC
TCACTCCTTCTTCAACGTCCTGAGTTTCAGACCGGGCATCAAGCATGACAGTATCGACAGGCTGTATTTCGTCGG
CGCCAGCACGCACCCTGGAACGGGAGTCCCCGTCTGTCTGGCGGGGAGCAAGATTGTGAGCCATCAGATCGTGAG
GGACTTGAGAGGGACGTCGTCGAGAGGGGATGTGCGTGTTTGGTTGCTTTGCTGCCTGCTGTTTGTTGTTGTCTT
GACCATGTTGTGTCTGATGGTGATGGGCTGGGGACGGGGGGCTCAGTTGAGAGAAGATGTGTGAAGCTCGGGAGT
CGAGTGAGTTCATGGGATGCCCTCGCTTCGAGGAACCAGGGGCTGGATGTTGTTAGCCAAGCAGCAGCAGCAGCA
GCGCAAGTACGACAACTCCATGTACAAAAGTAGTCTGCTCAAAAGAAGCAACCTGGATATGGTGAACAAGGCCCC
CTTAATCTCTACAGCCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail