Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00381
Gene name
Locationscaffold_01:1627825..1628659
Strand-
Gene length (bp)834
Transcript length (bp)774
Coding sequence length (bp)774
Protein length (aa) 258

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0981 0.0523 0.885 0.5226 0.0831 0.0053 0.3949 0.1329 0.2363 0.0036

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999579

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1511
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|212
Ophiocordyceps australis map64 (Brazil) OphauB2|3176
Ophiocordyceps camponoti-floridani Ophcf2|00381 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5283
Ophiocordyceps kimflemingae Ophio5|2757
Ophiocordyceps subramaniannii Hirsu2|11169

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00381
MRVALLATASLSAGLVAAQGTQPAPVIKANPSGASFEATLPAQAFTAGSLDGNVKGSIVASTPADGVGVEFKIQF
ENVPQEGGPFLYHVHEQPVPADGNCTKTLAHLDPYKRGEDPPCDSTRPETCQVGDLSGKHGKPNSTSTTFTATYV
DRFLSTSPQSNAFLGNVSFVFHFANKTRITCANFQSIGVSAAVGPSTGGGQSSAASTATVTASASAGTGSSSSPS
SSAVAFSGDAAISTLSMSLTMLSVAAAFAWVF*
Coding >Ophcf2|00381
ATGCGTGTCGCTCTCTTGGCCACCGCCTCCCTCTCGGCCGGCCTCGTCGCCGCACAGGGCACCCAGCCCGCGCCC
GTCATCAAGGCCAACCCTTCCGGCGCCAGCTTCGAGGCGACGCTGCCTGCTCAGGCCTTTACCGCTGGCTCGCTC
GACGGCAATGTCAAGGGCTCCATCGTGGCCAGCACGCCCGCTGATGGCGTGGGCGTCGAGTTTAAGATTCAGTTC
GAGAACGTTCCTCAGGAGGGCGGACCTTTCCTCTATCACGTCCATGAACAGCCCGTCCCGGCTGACGGCAACTGC
ACAAAGACTCTGGCTCACCTGGACCCTTATAAGCGCGGCGAAGACCCTCCCTGCGACTCGACTCGTCCCGAGACG
TGCCAGGTCGGAGACTTGAGCGGCAAGCACGGCAAGCCCAATTCTACCTCTACCACTTTCACCGCCACCTACGTC
GACCGCTTCCTGTCGACGAGCCCGCAGTCCAACGCCTTCTTGGGCAACGTCTCCTTTGTCTTTCACTTTGCCAAC
AAGACGCGCATCACCTGCGCCAACTTCCAGTCCATCGGCGTCTCTGCCGCCGTCGGCCCTTCGACCGGCGGAGGC
CAAAGCTCTGCCGCCTCCACTGCGACGGTCACTGCCTCGGCGTCCGCCGGCACTGGCTCCTCGTCGAGCCCCAGC
AGCTCGGCCGTGGCTTTTAGTGGCGATGCTGCCATTTCGACTCTTTCCATGTCGCTTACGATGCTGTCCGTGGCA
GCCGCCTTTGCCTGGGTGTTTTAG
Transcript >Ophcf2|00381
ATGCGTGTCGCTCTCTTGGCCACCGCCTCCCTCTCGGCCGGCCTCGTCGCCGCACAGGGCACCCAGCCCGCGCCC
GTCATCAAGGCCAACCCTTCCGGCGCCAGCTTCGAGGCGACGCTGCCTGCTCAGGCCTTTACCGCTGGCTCGCTC
GACGGCAATGTCAAGGGCTCCATCGTGGCCAGCACGCCCGCTGATGGCGTGGGCGTCGAGTTTAAGATTCAGTTC
GAGAACGTTCCTCAGGAGGGCGGACCTTTCCTCTATCACGTCCATGAACAGCCCGTCCCGGCTGACGGCAACTGC
ACAAAGACTCTGGCTCACCTGGACCCTTATAAGCGCGGCGAAGACCCTCCCTGCGACTCGACTCGTCCCGAGACG
TGCCAGGTCGGAGACTTGAGCGGCAAGCACGGCAAGCCCAATTCTACCTCTACCACTTTCACCGCCACCTACGTC
GACCGCTTCCTGTCGACGAGCCCGCAGTCCAACGCCTTCTTGGGCAACGTCTCCTTTGTCTTTCACTTTGCCAAC
AAGACGCGCATCACCTGCGCCAACTTCCAGTCCATCGGCGTCTCTGCCGCCGTCGGCCCTTCGACCGGCGGAGGC
CAAAGCTCTGCCGCCTCCACTGCGACGGTCACTGCCTCGGCGTCCGCCGGCACTGGCTCCTCGTCGAGCCCCAGC
AGCTCGGCCGTGGCTTTTAGTGGCGATGCTGCCATTTCGACTCTTTCCATGTCGCTTACGATGCTGTCCGTGGCA
GCCGCCTTTGCCTGGGTGTTTTAG
Gene >Ophcf2|00381
ATGCGTGTCGCTCTCTTGGCCACCGCCTCCCTCTCGGCCGGCCTCGTCGCCGCACAGGGCACCCAGCCCGCGCCC
GTCATCAAGGCCAACCCTTCCGGCGCCAGCTTCGAGGCGACGCTGCCTGCTCAGGCCTTTACCGCTGGCTCGCTC
GACGGCAATGTCAAGGGCTCCATCGTGGCCAGCACGCCCGCTGATGGCGTGGGCGTCGAGTTTAAGATTCAGTTC
GAGAACGTTCCTCAGGAGGGCGGACCTTTCCGTGAGTCGCGGCCTTTCCACGCTTGCAATTCCTCATCGACTTGA
GCTGACCGTTACGCAGTCTATCACGTCCATGAACAGCCCGTCCCGGCTGACGGCAACTGCACAAAGACTCTGGCT
CACCTGGACCCTTATAAGCGCGGCGAAGACCCTCCCTGCGACTCGACTCGTCCCGAGACGTGCCAGGTCGGAGAC
TTGAGCGGCAAGCACGGCAAGCCCAATTCTACCTCTACCACTTTCACCGCCACCTACGTCGACCGCTTCCTGTCG
ACGAGCCCGCAGTCCAACGCCTTCTTGGGCAACGTCTCCTTTGTCTTTCACTTTGCCAACAAGACGCGCATCACC
TGCGCCAACTTCCAGTCCATCGGCGTCTCTGCCGCCGTCGGCCCTTCGACCGGCGGAGGCCAAAGCTCTGCCGCC
TCCACTGCGACGGTCACTGCCTCGGCGTCCGCCGGCACTGGCTCCTCGTCGAGCCCCAGCAGCTCGGCCGTGGCT
TTTAGTGGCGATGCTGCCATTTCGACTCTTTCCATGTCGCTTACGATGCTGTCCGTGGCAGCCGCCTTTGCCTGG
GTGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail