Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00374
Gene name
Locationscaffold_01:1602868..1604538
Strand-
Gene length (bp)1670
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 3.9E-21 291 416
PF04676 CwfJ_C_2 Protein similar to CwfJ C-terminus 2 5.0E-14 466 529

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3746 0.9516 0.0315 0.0295 0.0978 0.0052 0.0261 0.0064 0.0079 0.0067

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4013
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6879
Ophiocordyceps australis map64 (Brazil) OphauB2|4306
Ophiocordyceps camponoti-floridani Ophcf2|00374 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3114
Ophiocordyceps kimflemingae Ophio5|5552
Ophiocordyceps subramaniannii Hirsu2|8065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00374
MASPKIIVLGSLNGMLIPAAQKLATLQAKNGFAMAILTGNAFARTLNADTREAVKSRRLKFPLPTYFTIGSHPLP
EEIAAKVEADEEIGQNLYFLGKRGFTTTTDGVHIAVLGGVPAAGREMQPHEYNYDDVMELEAGGRRTDLLLTSVW
PADIWKCSNVVLDPANQAMVQSSPSIADLCATLKPRYHLTASSGAFFYEREPFGHPFDSHAHELFTRFISLAPYD
NEAKAKAMYAFSLNRSDDGAVPIGATDSPLIATMQSRKRPPEDEEYSRFSRPRRHGKRRYMRPPPGPDRCYFCLS
NPNISTHMCCSIGEESYVTTAKGPIPETTTFAEHGLTFPGHFIIIPLPHAPTTKAIGRAEEAARAYNEMSRFRES
LQAMLSSKSSHKLGAITWEISRESNIHLIWQLTAVPAQLIRSGLAEAGFRVEAENSGYPPWVVDDLPLERQIDYG
DFLRIWLWADDGEDLNKGKSLVMPLPRNLLFDFQFSRRVIVKLLGLETRLSWQDCQQTVEEETSDAQAFREAFKD
WDFTIS*
Coding >Ophcf2|00374
ATGGCGAGCCCCAAGATCATCGTCCTAGGCAGCCTCAACGGCATGCTCATTCCCGCAGCCCAGAAGCTCGCAACG
CTGCAGGCCAAAAACGGCTTCGCCATGGCCATCCTCACGGGCAACGCCTTCGCCCGGACGCTCAACGCCGACACT
CGTGAGGCCGTGAAGAGTAGAAGACTGAAGTTTCCGCTTCCGACCTACTTCACCATCGGCTCCCACCCGCTGCCC
GAAGAGATCGCGGCCAAAGTCGAGGCCGATGAGGAAATCGGCCAGAATCTGTATTTTCTCGGGAAACGGGGCTTC
ACGACGACGACGGATGGCGTTCATATCGCCGTTCTCGGAGGTGTCCCAGCTGCCGGGCGCGAGATGCAGCCGCAC
GAGTACAACTACGACGATGTCATGGAGCTGGAAGCCGGCGGCCGCCGAACCGACCTTCTCCTAACGTCTGTCTGG
CCAGCCGACATCTGGAAATGTTCCAACGTGGTTCTCGACCCGGCTAACCAGGCCATGGTGCAGAGCTCGCCGTCG
ATAGCGGACCTATGCGCCACTCTCAAGCCGCGTTATCACCTCACGGCATCCTCCGGCGCCTTCTTCTACGAACGT
GAACCGTTTGGGCATCCATTCGATTCCCACGCACATGAACTCTTTACGCGCTTCATCTCGCTAGCTCCCTACGAC
AACGAGGCCAAGGCCAAGGCCATGTACGCCTTCAGCCTCAACAGGTCCGACGACGGCGCCGTCCCCATCGGAGCC
ACCGACTCACCACTCATCGCCACAATGCAGTCGAGGAAGCGACCTCCAGAAGATGAAGAATACAGCCGCTTCAGC
CGCCCCCGCCGCCACGGCAAACGACGCTACATGCGACCCCCTCCCGGGCCCGACCGATGCTATTTCTGCCTTTCC
AACCCCAACATCTCGACGCACATGTGCTGCAGCATAGGCGAAGAGTCGTACGTGACGACAGCAAAGGGGCCCATC
CCGGAGACCACGACCTTTGCCGAGCACGGACTCACCTTTCCAGGCCACTTCATCATCATCCCCCTCCCTCACGCG
CCCACGACCAAAGCCATAGGCCGCGCAGAAGAGGCAGCGCGCGCCTACAACGAGATGTCCCGCTTCCGTGAGTCG
CTTCAGGCCATGCTATCCAGCAAATCATCCCACAAGCTGGGCGCCATCACCTGGGAAATCAGCCGCGAATCCAAC
ATCCACCTCATCTGGCAGCTCACAGCCGTGCCAGCACAGCTGATTCGAAGCGGCCTCGCCGAGGCTGGCTTCCGC
GTCGAGGCCGAGAACAGCGGATATCCGCCCTGGGTAGTCGACGACCTACCCCTCGAGAGACAGATCGATTACGGC
GACTTCTTACGCATCTGGCTTTGGGCCGACGATGGCGAGGACTTGAATAAGGGCAAGTCTCTCGTCATGCCGTTA
CCCCGGAACCTGCTCTTCGACTTCCAATTCAGCCGTCGCGTCATCGTCAAGCTCTTGGGCCTCGAAACCCGCCTC
TCCTGGCAGGATTGCCAGCAGACGGTCGAAGAGGAGACGAGCGACGCCCAGGCGTTTCGCGAGGCCTTTAAGGAC
TGGGACTTTACCATCTCCTAG
Transcript >Ophcf2|00374
ATGGCGAGCCCCAAGATCATCGTCCTAGGCAGCCTCAACGGCATGCTCATTCCCGCAGCCCAGAAGCTCGCAACG
CTGCAGGCCAAAAACGGCTTCGCCATGGCCATCCTCACGGGCAACGCCTTCGCCCGGACGCTCAACGCCGACACT
CGTGAGGCCGTGAAGAGTAGAAGACTGAAGTTTCCGCTTCCGACCTACTTCACCATCGGCTCCCACCCGCTGCCC
GAAGAGATCGCGGCCAAAGTCGAGGCCGATGAGGAAATCGGCCAGAATCTGTATTTTCTCGGGAAACGGGGCTTC
ACGACGACGACGGATGGCGTTCATATCGCCGTTCTCGGAGGTGTCCCAGCTGCCGGGCGCGAGATGCAGCCGCAC
GAGTACAACTACGACGATGTCATGGAGCTGGAAGCCGGCGGCCGCCGAACCGACCTTCTCCTAACGTCTGTCTGG
CCAGCCGACATCTGGAAATGTTCCAACGTGGTTCTCGACCCGGCTAACCAGGCCATGGTGCAGAGCTCGCCGTCG
ATAGCGGACCTATGCGCCACTCTCAAGCCGCGTTATCACCTCACGGCATCCTCCGGCGCCTTCTTCTACGAACGT
GAACCGTTTGGGCATCCATTCGATTCCCACGCACATGAACTCTTTACGCGCTTCATCTCGCTAGCTCCCTACGAC
AACGAGGCCAAGGCCAAGGCCATGTACGCCTTCAGCCTCAACAGGTCCGACGACGGCGCCGTCCCCATCGGAGCC
ACCGACTCACCACTCATCGCCACAATGCAGTCGAGGAAGCGACCTCCAGAAGATGAAGAATACAGCCGCTTCAGC
CGCCCCCGCCGCCACGGCAAACGACGCTACATGCGACCCCCTCCCGGGCCCGACCGATGCTATTTCTGCCTTTCC
AACCCCAACATCTCGACGCACATGTGCTGCAGCATAGGCGAAGAGTCGTACGTGACGACAGCAAAGGGGCCCATC
CCGGAGACCACGACCTTTGCCGAGCACGGACTCACCTTTCCAGGCCACTTCATCATCATCCCCCTCCCTCACGCG
CCCACGACCAAAGCCATAGGCCGCGCAGAAGAGGCAGCGCGCGCCTACAACGAGATGTCCCGCTTCCGTGAGTCG
CTTCAGGCCATGCTATCCAGCAAATCATCCCACAAGCTGGGCGCCATCACCTGGGAAATCAGCCGCGAATCCAAC
ATCCACCTCATCTGGCAGCTCACAGCCGTGCCAGCACAGCTGATTCGAAGCGGCCTCGCCGAGGCTGGCTTCCGC
GTCGAGGCCGAGAACAGCGGATATCCGCCCTGGGTAGTCGACGACCTACCCCTCGAGAGACAGATCGATTACGGC
GACTTCTTACGCATCTGGCTTTGGGCCGACGATGGCGAGGACTTGAATAAGGGCAAGTCTCTCGTCATGCCGTTA
CCCCGGAACCTGCTCTTCGACTTCCAATTCAGCCGTCGCGTCATCGTCAAGCTCTTGGGCCTCGAAACCCGCCTC
TCCTGGCAGGATTGCCAGCAGACGGTCGAAGAGGAGACGAGCGACGCCCAGGCGTTTCGCGAGGCCTTTAAGGAC
TGGGACTTTACCATCTCCTAG
Gene >Ophcf2|00374
ATGGCGAGCCCCAAGATGTACGCGTCTCTGCCTCACACTTTTCTCCAGACTTTGAATCCATACTGACTCATGTTC
TTCCCTTCTCCCGCAGCATCGTCCTAGGCAGCCTCAACGGCATGCTCATTCCCGCAGCCCAGAAGCTCGCAACGC
TGCAGGCCAAAAACGGCTTCGCCATGGCCATCCTCACGGGCAACGCCTTCGCCCGGACGCTCAACGCCGACACTC
GTGAGGCCGTGAAGAGTAGAAGACTGAAGTTTCCGCTTCCGACCTACTTCACCATCGGCTCCCACCCGCTGCCCG
AAGAGATCGCGGCCAAAGTCGAGGCCGATGAGGAAATCGGCCAGAATCTGTATTTTCTCGGGAAACGGGGCTTCA
CGACGACGACGGATGGCGTTCATATCGCCGTTCTCGGAGGTGTCCCAGCTGCCGGGCGCGAGATGCAGCCGCACG
AGTACAACTACGACGATGTCATGGAGCTGGAAGCCGGCGGCCGCCGAACCGACCTTCTCCTAACGTCTGTCTGGC
CAGCCGACATCTGGAAATGTTCCAACGTGGTTCTCGACCCGGCTAACCAGGCCATGGTGCAGAGCTCGCCGTCGA
TAGCGGACCTATGCGCCACTCTCAAGCCGCGTTATCACCTCACGGCATCCTCCGGCGCCTTCTTCTACGAACGTG
AACCGTTTGGGCATCCATTCGATTCCCACGCACATGAACTCTTTACGCGCTTCATCTCGCTAGCTCCCTACGACA
ACGAGGCCAAGGCCAAGGCCATGTACGCCTTCAGCCTCAACAGGTCCGACGACGGCGCCGTCCCCATCGGAGCCA
CCGACTCACCACTCATCGCCACAATGCAGTCGAGGAAGCGACCTCCAGAAGATGAAGAATACAGCCGCTTCAGCC
GCCCCCGCCGCCACGGCAAACGACGCTACATGCGACCCCCTCCCGGGCCCGACCGATGCTATTTCTGCCTTTCCA
ACCCCAACATCTCGACGCACATGTGCTGCAGCATAGGCGAAGAGTCGTACGTGACGACAGCAAAGGGGCCCATCC
CGGAGACCACGACCTTTGCCGAGCACGGACTCACCTTTCCAGGCCACTTCATCATCATCCCCCTCCCTCACGCGC
CCACGACCAAAGCCATAGGCCGCGCAGAAGAGGCAGCGCGCGCCTACAACGAGATGTCCCGCTTCCGTGAGTCGC
TTCAGGCCATGCTATCCAGCAAATCATCCCACAAGCTGGGCGCCATCACCTGGGAAATCAGCCGCGAATCCAACA
TCCACCTCATCTGGCAGCTCACAGCCGTGCCAGCACAGCTGATTCGAAGCGGCCTCGCCGAGGCTGGCTTCCGCG
TCGAGGCCGAGAACAGCGGATATCCGCCCTGGGTAGTCGACGACCTACCCCTCGAGAGACAGATCGATTACGGCG
ACTTCTTACGCATCTGGCTTTGGGCCGACGATGGCGAGGACTTGAATAAGGGCAAGTCTCTCGTCATGCCGTTAC
CCCGGAACCTGCTCTTCGACTTCCAATTCAGCCGTCGCGTCATCGTCAAGCTCTTGGGCCTCGAAACCCGCCTCT
CCTGGCAGGATTGCCAGCAGACGGTCGAAGAGGAGACGAGCGACGCCCAGGCGTTTCGCGAGGCCTTTAAGGACT
GGGACTTTACCATCTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail